SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005910 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005910
Domain Number 1 Region: 324-545
Classification Level Classification E-value
Superfamily vWA-like 1.07e-51
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 162-353
Classification Level Classification E-value
Superfamily vWA-like 7.47e-42
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 3 Region: 29-124
Classification Level Classification E-value
Superfamily LCCL domain 1.7e-27
Family LCCL domain 0.00000252
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005910   Gene: ENSOARG00000005504   Transcript: ENSOART00000006000
Sequence length 552
Comment pep:known_by_projection chromosome:Oar_v3.1:18:40457701:40470054:1 gene:ENSOARG00000005504 transcript:ENSOART00000006000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPFPWPPLGFRGVRWELPREPVGGEGAVPIAITCFTRGLDIRKEKADVLCPGGCPLEEFS
VFGHIVYASVSSICGAAVHRGVIGNSGGPVRIYSLPGRENYSSVVANGIQSQTLSRWSTS
FTVTKGKSGTQEATGQAVSTAHPATGKRLKKTPEKKTGNKDCKADIAFLIDGSFNIGQRR
FNLQKNFVGKVALMLGIGTEGPHVGLVQASEHPKIEFYLNNFTSAKDVLFAIKEVGFRGG
NSNTDLGKALKHTAQKFFTADTGVRKGIPKVVVVFIDGWPSDDIEEAGIVAREFGVNVFI
VSVAKPIPEELGMVQDVAFVDKAVCRNNGFFSYHMPNWFGTTKYVKPLVQKLCTHEQMMC
SKTCYNSVNIAFLIDGSSSVGESNFRLMLEFVSNIAKTFEISDIGAKIAAVQFTYDQRRE
FSFTDYSTKENVLAVIRNIRYMSGGTATGDAISFTVRNVFGPMRDSPNKNFLVIVTDGQS
YDDVRGPAAAAHNAGITIFSVGVAWAPLDDLKDMASKPKESHAFFTREFTGLEPIVSDVI
RGICRDFLESQQ
Download sequence
Identical sequences W5P656
ENSOARP00000005910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]