SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005918 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005918
Domain Number 1 Region: 43-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000327
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005918   Gene: ENSOARG00000005511   Transcript: ENSOART00000006008
Sequence length 196
Comment pep:known_by_projection chromosome:Oar_v3.1:9:21130619:21159808:-1 gene:ENSOARG00000005511 transcript:ENSOART00000006008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWPPTSRHELVTALDAGGSGSSSCSGQHLGHGSTGEIEPWHKNCIAYTSPWSPCSTSCG
LGVSTRVSNVNARCWPEQESRLCNLRPCDVDLRPHIKEGKKCLAVYQPEAPVNFTLAGCT
STRAYRPKYCGVCTDSRCCIPYKSKTISISFQCPDGPDFSRQALWINACFCNLSCQNPND
IFADLDSYPDFSEIAN
Download sequence
Identical sequences W5P664
ENSOARP00000005918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]