SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000005927 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000005927
Domain Number 1 Region: 427-735
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-81
Family Aminomethyltransferase folate-binding domain 0.0000735
Further Details:      
 
Domain Number 2 Region: 14-230,335-416
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-54
Family FAD-linked reductases, N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 232-334
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.2e-19
Family L-aminoacid/polyamine oxidase 0.06
Further Details:      
 
Domain Number 4 Region: 737-830
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000523
Family Aminomethyltransferase beta-barrel domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000005927   Gene: ENSOARG00000005515   Transcript: ENSOART00000006017
Sequence length 851
Comment pep:known_by_projection chromosome:Oar_v3.1:14:1265599:1291738:-1 gene:ENSOARG00000005515 transcript:ENSOART00000006017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVRGPAVALPAQAQVVVCGGGIMGTSVAYHLSKMGWKDVVLLEQGRLAAGSTRFCAGIL
STARHLAIEQKMADYSNKLYHQLEQETGIQTGYTRTGSIFLAQTQDRLISLKRINSRLNV
VGIPCEIVSPKKVAELHPLLNVHDLVGAMHVPEDAVVSSADVALALASAASQATGVQIYD
RTSILHVMVKRGQVTGVETDKGQIQCQYFVNCAGQWAYELGLCSEEPVSIPLHACEHFYL
LTRPWETPLPSSTPTVVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQNLQED
WDHFEPLLSSLLRRMPQLETLEIVKLVNCPETFTPDMRCIVGESPSVRGYFILVGMNSAG
LSFGGGAGKYLAEWMVHGYPSENVWELDLKRFGALQSSRTFLRHRVMEVMPLLYDLKVPR
WDFQTGRQLRTSPLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKPDWFE
IVESEVKCCKEAVCVIDMSSFTKFEITSTGDQALEILQYLFSNDLDVPVGHIVHTGMLNE
RGGYENDCSIARLSKRSFFMISPTDQQVHCWAWLKKYMPEDSNLILEDVTWKYTALNLIG
PRAVDVLSELSYAPMTPDHFPSLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIEYALH
VYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGGESRVKLDKGVD
FIGRDALLQQRQNGVYKRLTMFILDDHDTDLDLWPWWGEPIYRNGRYVGKTTSSAYGYTL
ERHVCLGFVHNFSEDTGEEQVVTADFINRGEYEIDIAGHRFQAKAKLYPVPSLLTHKRRK
EDVELSDLHGK
Download sequence
Identical sequences W5P673
ENSOARP00000005927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]