SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006073 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006073
Domain Number 1 Region: 578-933
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.67e-110
Family PDEase 0.00000226
Further Details:      
 
Domain Number 2 Region: 389-573
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-46
Family GAF domain 0.0000000821
Further Details:      
 
Domain Number 3 Region: 222-402
Classification Level Classification E-value
Superfamily GAF domain-like 1.68e-35
Family GAF domain 0.0000000355
Further Details:      
 
Domain Number 4 Region: 41-193
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000122
Family GAF domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006073   Gene: ENSOARG00000005656   Transcript: ENSOART00000006165
Sequence length 938
Comment pep:known_by_projection chromosome:Oar_v3.1:15:50339073:50372682:-1 gene:ENSOARG00000005656 transcript:ENSOART00000006165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCGIMYPVNSCYSQHLTRLKNETVRDHPPPRETEWDPDSANDALLSLGSVIDMAGLQQAV
KEALSAVLPKVETVYTYLLDREFRLVCEEPPHELPQEGKVREAVISRKRLGCNGLGPSDL
PGKPLARLVAPLAPDTQVLVIPLVDKEAGAVAAVILVHCGQLSDNEEWSLQAVEKHTLVA
LKRVQALQQRECSAAPEATQNPPEEAVGDQKGGVAYTDQDRKILQRRGRELYDLDASSLQ
LKVLQYLQQETQASRCCLLLVSEDNLQLSCKVIGDKVLEEEISFPLTTGRLGQVVEDKKS
IQLKDLTSEDVQQLQSMLGCEVQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQDERV
TQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEARNLS
NAEICSVFLLDQNELVAKVFDGGVVEDESYEIRIPADQGIAGHVATTGQILNIPDAYAHP
LFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFSIYCG
ISIAHHKSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFASF
TYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHAFS
VSHFCYLLYKNLELTNYLEDMEIFALFISCMCHDLDHRGTNNSFQVASKSVLAALYSSEG
SVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQKM
AEVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMGNR
PMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHKFT
IRGLPSNNSLDFLDEEYEVPDLDGARAPINGCCSLDAE
Download sequence
Identical sequences W5P6L9
ENSOARP00000006073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]