SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006105 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006105
Domain Number 1 Region: 140-406
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.55e-42
Family WD40-repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 52-127
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000105
Family F-box domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006105   Gene: ENSOARG00000005690   Transcript: ENSOART00000006198
Sequence length 454
Comment pep:known_by_projection chromosome:Oar_v3.1:2:2693449:2722938:1 gene:ENSOARG00000005690 transcript:ENSOART00000006198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKDFETWLDNISVTFLSLTDLQKNETLDHLISLSGAVQLRHLSNNLETLLKRDFLKLL
PLELSFYLLKWLDPQTLLTCCLVSKQWNKVISACTEVWQAACKSLGWQIDDSVQDALHWK
KVYLKAILRMKQLEDHEAFETSSLIGHSARVYALYYKDGLLCTGSDDLSAKLWDVSTGQC
VYGIQTHTCAAVKFDEQKLVTGSFDNTVACWEWSSGARTQHFRGHTGAVFSVDYNDELDI
LVSGSADFTVKVWALSAGTCLNTLTGHTEWVTKVVLQKCKVRSLLHSPGDYILLSADKYE
IKIWPIGREINCKCLKTLSVSEDRSICLQPRLHFDGKYIVCSSALGLYQWDFASYDILRV
IKTPEIANLALLGFGDIFALLFDNRYLYILDLWTESLISHWRLPEYRKSKRGSSFLAGEA
SWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
Download sequence
Identical sequences W5P6Q1
XP_004004019.1.66739 XP_014948440.1.66739 ENSOARP00000006105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]