SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006183 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006183
Domain Number 1 Region: 429-516
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000922
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006183   Gene: ENSOARG00000005767   Transcript: ENSOART00000006277
Sequence length 532
Comment pep:known_by_projection chromosome:Oar_v3.1:3:161757842:161763440:-1 gene:ENSOARG00000005767 transcript:ENSOART00000006277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGMAFALLTSVPPVFGLYTSFFPVLIYTLLGTGRHLSTGTFAVLSLMTGSAVERLVPE
PLSGNLSGIEREQLDAQRVGAAAAVAFGSGALMLGMFALQLGVLATFLSEPVVKALTSGA
ALHVLVSQLPSLLGVPLPRQIGCFALFKTLAAVLTALPSSSPAELTISALSLALLVPVKE
LNVRFRDRLPTPIPGEIAMVLLASVLCFTSSLDTRYNVQIVGLLPGGFPQPLLPSLAELP
RILADSLPMALVTFAVSASLASIYADKYSYTIDSNQELLAHGVSNLVSSLFSCFPNSATL
ATTSLLVDAGGNTQLAGLFSCMVVLSVLLWLGPLFYYLPKAVLACINISSMRQMFFQMRE
LPQLWRISRVDFAVWTVTWVAVVTLSVDLGLAVGVVFSMMTVVCRTQRVQCLALGLAEGT
ELYRPLRESHKLLQVPGLCILSYPAPLYFGTRGQFRRVLEWHLGLGEGSKEAPKTGGPPD
AAAEPVRVVVLDCGGVTFADAAGAREVVQVRERAKEEVPLWFHEHPLMDLTL
Download sequence
Identical sequences W5P6X9
XP_012030044.1.66739 ENSOARP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]