SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006351 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006351
Domain Number 1 Region: 33-143
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-36
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 295-415
Classification Level Classification E-value
Superfamily TIMP-like 7.22e-36
Family Netrin-like domain (NTR/C345C module) 0.0002
Further Details:      
 
Domain Number 3 Region: 154-267
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006351   Gene: ENSOARG00000005926   Transcript: ENSOART00000006448
Sequence length 415
Comment pep:known_by_projection chromosome:Oar_v3.1:1:244192902:244276222:1 gene:ENSOARG00000005926 transcript:ENSOART00000006448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGAWAPLCLLLVAAAQHSRPQLSERPVFTCGGILTGESGFIGSEGFPGVYPPNSKCT
WKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYNGHANGQRIGRFCGTFRPGALVSSSN
KMMVQMISDANTAGNGFMAMFSAAEPNERGDQYCGGLLERPSGSFKTPNWPDRDYPAGVA
CVWHIVAPKNQLIELKFEKFDVERDNYCRYDYVAVFNGGEINDAERIGKYCGDSPPAPIV
SERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTALPVTTTFPATTSLKPTVALCQQK
CRRSGTLESNYCSSNFVLAGTVITTIPRGGSLHATVSIINIYKEGNLAIQQAGKNMSAKV
IVVCKQCPLLRRGLNYIIMGQVGEDGRGKLMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences W5P7E7
ENSOARP00000006351 XP_004003333.1.66739 XP_011985912.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]