SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006356 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006356
Domain Number 1 Region: 493-830
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 9.14e-111
Family PDEase 0.000000303
Further Details:      
 
Domain Number 2 Region: 56-250
Classification Level Classification E-value
Superfamily GAF domain-like 2.8e-32
Family GAF domain 0.00037
Further Details:      
 
Domain Number 3 Region: 237-289,321-458
Classification Level Classification E-value
Superfamily GAF domain-like 4.8e-30
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006356   Gene: ENSOARG00000005923   Transcript: ENSOART00000006453
Sequence length 859
Comment pep:known_by_projection chromosome:Oar_v3.1:5:58707752:58787966:-1 gene:ENSOARG00000005923 transcript:ENSOART00000006453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVTAEEVEKFLDSNVSFAKQYYNLRYRAKVISDLLGPREAAVDFSNYHPLSSVEESEI
IFDLLRDFQDNLQAEKCIFNVMKKLCFLLQADRMSLFMYRARNGIAELATRLFNVHKDAV
LEECLVAPDSEIVFPLDMGVVGHVALSKKIVNVPNTEEDEHFCDFVDTLTEYQTKNILAS
PIMNGKDVVAIIMAVNKVDGPHFTKNDEEILLKYLNFANLIMKVFHLSYLHNCETRRGQI
LLWSGSKVFEELTDIERQFHKALYTVRAFLNCDRYSVGLLDMTKQKEFFDVWPVLMGEAP
PYAGPRTPDGREINFYKVIDYILHGKEDIKVIPNPPPDHWALVSGLPTYVAQNGLICNIM
NAPAEDFFAFQKEPLDESGWMIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEMDETLM
ESLAQFLGWSVLNPDTYESMNKLENRKDIFQDMVKYHVKCDNEEIQTILKTREVYGKEPW
ECEEEELAEILQGELPDADKYEINKFHFSDLPLTELELVKCGIQMYYELKVVDKFHIPQE
ALVRFMYSLSKGYRRITYHNWRHGFNVGQTMFSLLVTGKLKRYFTDLEALAMVTAAFCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKTLLRDESLNIFQNLNRRQHEHAIH
MMDIAIIATDLALYFKKRTMFQKIVDQSKTYETQQEWTQYMMLDQTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLQQNPIPMMDRNKADELPKLQVGFIDFV
CTFVYKEFSRFHEEITPMLDGITNNRKEWKALADEYETKMKELEGEKQKQQAANQAAAGS
QPGGKQPGGGPASKSCCVQ
Download sequence
Identical sequences W5P7F2
XP_004009015.1.66739 XP_011968765.1.54773 ENSOARP00000006356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]