SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006377 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006377
Domain Number 1 Region: 97-276
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.83e-56
Family F-box associated region, FBA 0.00021
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000523
Family F-box domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006377   Gene: ENSOARG00000005955   Transcript: ENSOART00000006474
Sequence length 279
Comment pep:novel chromosome:Oar_v3.1:14:47899213:47901192:-1 gene:ENSOARG00000005955 transcript:ENSOART00000006474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEASTSWGLPARVPAPHHEPQEAPGPNQLPIEMLQKVLSYLPPSTLLRHCRPVCRRWRDV
VDGWDLWRSILPWRHPDLWPVIRTCLPPADAPGPCILGRFCERRPIGRNLLRKPRGLGGF
QKWTVLSREDDWTEKENLEVMPRAYMQTSFLSSYRRYHKKQVLDLEKEGLWRELLDSGNI
EICVSDWRNDRQGIDCIYQLTVHLLDASQAILDHFSPLPFPIRRSRNSVSSRASHVFSNI
KKGVRFVSFERHIWDLEFRNEQYGVSLMNSSVIVRVCRP
Download sequence
Identical sequences W5P7H3
ENSOARP00000006377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]