SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006391 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006391
Domain Number 1 Region: 121-301
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.06e-49
Family F-box associated region, FBA 0.00049
Further Details:      
 
Domain Number 2 Region: 39-114
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000536
Family F-box domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006391   Gene: ENSOARG00000005966   Transcript: ENSOART00000006488
Sequence length 302
Comment pep:novel chromosome:Oar_v3.1:14:47951370:47956868:-1 gene:ENSOARG00000005966 transcript:ENSOART00000006488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGGVGGEEGVGGAAAAGPGEETTGASASQSLPACVPASDPESEEAPGLSQLPIEMLLKVL
TYLPTSVLLGQCRHVCRYWRYLVDTRAVWLSVLPYSHAKLWPVFRSCLPRDDDDDPRPCL
LGRFCERRPLGRNLYPNPHGIGCPWDGLEVRGRDERLQETPGTYPRAGRQARNLGTNIFS
FNRWCYKKQVLDLEEEGLWPELLDSGKIEICVSARWADQEASVCLYELIIQLLDAKQAKL
HHFSPRLIHQGTTSIPFKTDHLFCNLKRGVRFVSLEHWIWDMGFLPEDYGIIVPKASVIV
QV
Download sequence
Identical sequences W5P7I7
ENSOARP00000006391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]