SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006419 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006419
Domain Number 1 Region: 1278-1398
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-33
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 2 Region: 231-344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-33
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 3 Region: 934-1040
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 4 Region: 68-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-32
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 5 Region: 1452-1572
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-31
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 6 Region: 1623-1742
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 7 Region: 1810-1913
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-29
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 8 Region: 753-874
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 9 Region: 586-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-26
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1101-1216
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-21
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 11 Region: 2523-2594
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.07e-18
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 12 Region: 2407-2475
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-18
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 13 Region: 2166-2228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5e-18
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 14 Region: 2223-2280
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.64e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 15 Region: 2282-2355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2464-2534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.29e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2583-2652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000202
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2703-2771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 873-937
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000054
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1977-2042
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000973
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 7-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000132
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 22 Region: 2108-2170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 23 Region: 177-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 1047-1111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 2641-2698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000057
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 26 Region: 2339-2401
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000903
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 27 Region: 1223-1286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 1570-1639
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 1915-1988
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000297
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 698-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000403
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 31 Region: 1397-1462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000598
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 528-588
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000648
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 33 Region: 1741-1805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000148
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 34 Region: 2762-2819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 35 Region: 428-522
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000576
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006419   Gene: ENSOARG00000005968   Transcript: ENSOART00000006516
Sequence length 3047
Comment pep:known_by_projection chromosome:Oar_v3.1:26:1902642:2316386:-1 gene:ENSOARG00000005968 transcript:ENSOART00000006516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKGGCGDPGIPAYGKRTGSSFLHGDTLTFECQAAFELVGERVITCQQNNQWSGNKPSC
VFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFDFLAV
KDDGISDITVLGTFSGHEVPSQLASSGHIVRLEFQSDHSTTGRGFNITYTTFGQNECHDP
GIPINGRRFGDRFLLGSSVSFHCDDGFVKTHGSESITCILQDGNVVWSSTVPRCEAPCGG
HLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRDGPAS
SSPLIGEYHGTQAPQFLISTGNFMYLLFSTDNSRSSVGFLIRYEKSEWIESEACVESEKS
ENVCMESECMGVESERTFHCTSPLCCLLTREPLVCERNHQWNHALPSCDDNTSIGYLHFQ
KFTVLRKGFPYFPPNPISRKKQVNLTYLSGVQMTFHTFHLESSHDYLLITEDGSFSEPVA
RLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSEYDLEPCDDPGVPAFSRRI
GFHFGVGDALTFSCFPGYRLEGATKLTCLGGGRRVWSAPLPRCVAECGASVKGNEGTLLS
PNFPSNYDNNHECIYQIETEAGKGIHLRAQSFQLFEGDILKVYDGKDSSSRPLGAFTRNE
LVGLVLNSTSNHLWLEFNSNGSDTDQGFQLTYTSFDLVKCEDPGTPNYGYRIRDEGHFTD
TVVLYSCNPGYAMHGGGTLTCLSGDRRVWDRPLPSCVAECGGRIHAATSGRILSPGYPAP
YDNNLHCTWVVEADPGKTIRLSFILYSGDRPHDILRVWDGPADSAILLKEWSGSALPEDI
HSTFNSLTLQFDSDFFISKSGFSVQFSTSIASTCNDPGMPQNGTRYGDSREPGDTITFQC
DPGYQLQGQAKITCVQLNNRFFWQPDPPTCIAACGGNLTGPAGVILSPNYPQPYPPGKEC
DWRVRVNPDFVIALIFKSFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGNSL
FLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYKIA
DPSSITCVIGGDGKPAWNRVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITV
PKEFVVFGQFAYFQTALNDLAELFDGTHPQARLLSSLSGSHSGETLPLATSNQILLRFSA
KSGAPARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGSEFSAGSIVRFECNPGYLLQGST
AIRCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCVWKIIVTEG
SGIQIQVISFATEQNWDSLEIYDGGDASAPRLGSFSGTTVPALLNSTSNQLYLHFQSDIS
VAAAGFHLEYKTVGLAACQEPALPSNSIKTGDRYMVNDVLSFQCEPGYTLQQGRSHISCM
PGTVRRWNYPSPLCIATCGGTLSSMGGVVLSPGFPGTYPNNLDCTWKISLPIGYGAHIQF
LNFSTEANHDYLEIQNGPYHTSPMIGQFSGPDLPSALLSTTHETLIHFYSDHSQNRPGFK
LTYQAYELQNCPDPPPFQNGYMVNSDYSVGQSISFECYPGYILIGHPVLTCQHGINRNWN
YPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCIWLISVPPGHGVYINFTLLQTEAV
NDYIAVWDGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHAFQLK
KCQPPPAVPQAEMLTEDEDFEIGDFVKYQCHPGYTLSGMDTLTCKLSSQLQFEGSLPTCE
AQCPANEVRTESSGVILSPGYPGNYFNSQTCSWSIRVEPNYNITIFVDTFQSEKQFDALE
IFDGSSGQSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKKGFKIRYSAPYCSLTH
TVKNGGVLNRTAGEAGSKVQYFCKPGYRMIGHSNATCRRNPVGMYQWDSLAPLCQAVSCG
IPESPGNGSFTGNEFTLDSKVTYDCNEGFKLDASQQATAVCQEDGLWSNRGKPPTCKPIF
CGGECRSLKQSVTWRLQRGQNQSFGNKILLVYNVKTLLQKMCILMCQAFSSFIHEKKREK
KRISSVISCGSLSFPPNGNKIGTLTVYGATAIFTCNSGYTLVGSHVRECLANGLWSGPET
RCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGHTPVC
VPITCGHPGNPAHGSTNGSEFNLNDVVNFTCNPGYLLQGASRAQCRSNGQWSSPLPTCRA
VVNCSDPGLVENAVRHEHQNLAGGFEYGVTVVYQCKRGFYLLGSSALTCMANGLWDRSLP
KCLVISCGHPGVPANAILTGDLFTYGAVVHYSCRGSRSLVGDSSRACQEDSHWSGALPHC
TGNNPGFCGDPGTPAHGSRLGEEFKAKSLLRFSCEMGYQLRGSAERTCLLNGSWSGLQPV
CEAVSCGNPGTPTHGKIISSDGVVFSSSVVYACWDGYRTSGLTTRHCTANGTWTGTAPDC
TIISCGDPGTLANGIQFGTDFTFNKTVSYQCNPGYTMEPATSPTIRCTKDSTWNHSKPTC
KAVTCGQPPPVQDGKVEGTDFRWGASISYSCAHGFQLSQPAILSCEGRGVWKGEVPQCLP
VFCGDPGTPAEGRLSGKSFTYRSEVFFQCKSPLLLVGSSRRVCQADGTWSGVQPTCIDPA
HNTCPDPGTPQFGIQNSSRGYEVGSMVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIP
HACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKS
KGVREVNETVTKTPVPSDVFFIHSVWKGYYEYLGKRQPATLTVDWFNATSSKVNATFTDS
QGELKLAGVYKKEEAHLLLKAFQIKGPVDIFVSNFENDNWGLDGYVSSGLERGGFTFQGD
IHGKDFGKFKLERQGPVSSDQDSSSHYQGTSSGSVAGPFFALILSGFAFYLYKHRTRPKV
QYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences W5P7L5
ENSOARP00000006419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]