SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006478 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006478
Domain Number 1 Region: 538-570,651-727
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000334
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006478   Gene: ENSOARG00000006025   Transcript: ENSOART00000006576
Sequence length 782
Comment pep:known_by_projection chromosome:Oar_v3.1:4:48690960:48754383:1 gene:ENSOARG00000006025 transcript:ENSOART00000006576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGDRLEPPPLPEYSCSYVVSRPVYNELAFQQQYEQRPKERKTLRENLAQGCSCSRKR
TLRMMKTLLPILDWLPKYQIKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPVGYGLYSA
FFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLSMAPDEHFLVSSSNGTALNTTIIDFAA
RDAARVLIASTLTLLVGIIQLIFGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQLKIVL
NVSTKNYNGILSIIYTLIEIFQNIGNTNLADFIAGLLTIIICMAVKELNDRFKHKIPVPI
PIEVIVTIAATAISYGVDLEKNYNAGIVKSIPSGFLPPAMPSVSLFSEMLTASFSISVVA
YAIAVSVGKVYAIKHDYTIDGNQEFIAFGISNIFSGLFSCFVATTALSRTAVQESTGGKT
QVAGVISAGVVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPHLWRQNKTDAV
IWVFTCMASIILGLDLGLLAGLVFGFLTVVLRVQFPSWNSLGSIPSTDIYKSTKNYKNIE
ELEGVKILRFSSPIFYGNVDGLKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKKGQLRAT
KNGIISGAGSSNNAFEPDEDIENPEEPDIPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAVSFLDVVGVRSLRVIVKEFQRIDVNVYFASLQEDHVIEKLEKCGFFNDNNIRKDIF
FMTVHDAVLHLQNQVKSQEVQDSILETIALIQDCKDPLELMEAEMIEEELDVQDEAIRRL
AS
Download sequence
Identical sequences W5P7S4
ENSOARP00000006478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]