SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006609 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006609
Domain Number 1 Region: 665-816
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-43
Family C-type lectin domain 0.00000547
Further Details:      
 
Domain Number 2 Region: 151-265
Classification Level Classification E-value
Superfamily C-type lectin-like 1.42e-42
Family Link domain 0.0056
Further Details:      
 
Domain Number 3 Region: 267-369
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-29
Family Link domain 0.0076
Further Details:      
 
Domain Number 4 Region: 44-155
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000403
Family V set domains (antibody variable domain-like) 0.049
Further Details:      
 
Domain Number 5 Region: 816-875
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000931
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006609   Gene: ENSOARG00000006170   Transcript: ENSOART00000006712
Sequence length 914
Comment pep:known_by_projection chromosome:Oar_v3.1:1:105182279:105195515:1 gene:ENSOARG00000006170 transcript:ENSOART00000006712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLFLPLLAALVLAWIPAALADALEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPSPSRRAAQGSPRVKWTFLSGGREAEVLVARGLRVKVSEAYRFRVALPAYPASLTDV
SLVLSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFTGAQEACA
RIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEELNGELFLGAPPEKLTLEEARTYCQERGAKIATTGQLYAAWDGGLDR
CSPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRATDSAQ
PSAIPEAANPGSDLASDALESIVTVTETLEELKLPQEAVESESRGAIYSIPIIEDGGGGS
STPEDPAEAPRTLLEFETQSIVPPLGSSEEEGKVLEQEEKYRGEEEKEEEEEEEEVEDKA
LWAWPSELSSLDPEAPLPTEPAPEESLTQASPPVRAALQPGASPPPYDDPEAPRPPRVLG
PPTKTLPTPREGNLASPPPSTPVGAREREEETGGPELSGAPRGESEETGSSEGAPSLLPA
TRAPGDTRDLESPSEENSRRTVPAGTSVRAQPVLPTDSASRGGVAVAPSSGDCVPSPCHN
GGTCLEEEEGVRCLCLPGYGGDLCDVGLHSCSPGWDAFQGACYKHFSTRRSWEEAENKCR
MYGAHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSY
FLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVD
TVLRYRCREGLTQRNLPLIRCQENGRWGPPQISCVPHRPARALRPIEAQEGRQRRLVGHW
KARLNPSPNPAPGP
Download sequence
Identical sequences W5P854
ENSOARP00000006609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]