SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006828 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006828
Domain Number 1 Region: 248-468
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.44e-58
Family Reprolysin-like 0.0005
Further Details:      
 
Domain Number 2 Region: 557-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000314
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 3 Region: 843-900
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 904-960
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 5 Region: 1016-1070
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 6 Region: 963-1018
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000405
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006828   Gene: ENSOARG00000006371   Transcript: ENSOART00000006932
Sequence length 1118
Comment pep:known_by_projection chromosome:Oar_v3.1:16:14045920:14324177:1 gene:ENSOARG00000006371 transcript:ENSOART00000006932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEILWKTFTWILSLVMASSEFHSDYRLSYSSQEEEFLTYLEHYQLTIPIRVDQNGAFLSF
TVKNDKHSRRRRSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKD
GPQWKHDFLDNCHYTGYLQDQRSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKH
FSYENGHPHVIYKKSTLQQRHLYDHSHCGVSDLLRSGKPWWLNDTSAFPSSLPINGTHIH
QRQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMNIVAKLYRDSSLGNVVNIIV
ARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHHDNAVLITRY
DICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNS
CGTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVA
PGQVYDADEQCRFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEK
GWCYQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLG
ERKRYRSCNTDPCPLGARDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGY
NFYTERSPAVIDGTQCNADSLDICINGECKHVGCDNILGSDAREDRCRVCGGDGSTCDAI
EGFFNDSLPRGGYMEVVQIPRGSVHIEVKEVAMSKNYIALKSEGDDYYINGAWTIDWPRK
FDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNE
VGFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRTCNTEPC
PPEWFIGDWLECSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPIEKEPCNNQSC
PPQWVALDWSECTPKCGPGFKHRIVLCKSSDLSKTFPATQCSEESKPPVRIRCSLGRCPP
PRWVAGDWGQCSAQCGLGQQMRTVQCLSYTGQASSDCPETSRPPSMQQCESKCDSTPISS
TEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences W5P8S1
ENSOARP00000006828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]