SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000006840 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000006840
Domain Number 1 Region: 855-936
Classification Level Classification E-value
Superfamily DEATH domain 1.53e-20
Family DEATH domain, DD 0.0000102
Further Details:      
 
Domain Number 2 Region: 158-249
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000225
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 248-299
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 4 Region: 301-356
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 5 Region: 51-153
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000889
Family I set domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000006840   Gene: ENSOARG00000006382   Transcript: ENSOART00000006944
Sequence length 945
Comment pep:known_by_projection chromosome:Oar_v3.1:25:27264279:27284918:1 gene:ENSOARG00000006382 transcript:ENSOART00000006944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWLRHGGHMFILLLKSQLIVWRLALALTRADSGGQAPPASFPAAPAETLPHFLQEPQDA
YIVKNKPVELGCRAFPATQIYFKCNGEWVSQSGHVTQEGLDEATALQVREVQIEVSRQQV
EELFGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPP
EGVPVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRST
TATVIVYVNGGWSSWADWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTT
VCPVDGGWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVQNK
KTLSDPKSHLLETSGDMALYAGLVVSIFVVVAVLIVVAVGGYRRNCRDFDTDITDSSAAL
PGGFHPVNFKTARPNNPQLLHPSVPPDLTASASIYRGPKYALQDSADKIPMTNSPLLDPL
PNLKIKVYSSSTTGSGPGLADGADLLGVLPPGTYPGDFSRDTQFLHLRSASLGSQQLLGL
PRDPGSSVSSTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAENTLPLSEGT
QTVLSPAVTCGPTGLLLCRPVILTVPHCAEVSAGNWIFQLKTQAHQGHWEEVVTLDEETL
NTPCYCQLEARSCHILLDQLGTYVFTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCL
EDTPVALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQAG
DIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDALC
SAPSSVATTQLGPYAFKIPLSIRQKICNSLDAPNSRGQHWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAMATPGGC
Download sequence
Identical sequences W5P8T3
ENSOARP00000006840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]