SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007031 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007031
Domain Number 1 Region: 180-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000695
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 241-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000584
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 3 Region: 127-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family EGF-type module 0.0038
Further Details:      
 
Domain Number 4 Region: 40-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000361
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 522-626
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000526
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007031   Gene: ENSOARG00000006568   Transcript: ENSOART00000007138
Sequence length 752
Comment pep:known_by_projection chromosome:Oar_v3.1:2:11289593:11425449:1 gene:ENSOARG00000006568 transcript:ENSOART00000007138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPWGVCIPLGRLLLLLLLLSLARGAPRSWSQDDFHSDICATCHEHATCLKRERMSIC
ICKYGFVGNGRTHCIDKDECQFGASVVCGNHTSCHNTPGGFYCICLEGYRATNNNKTFIP
NDGTYCTDIDECEVSSRCRYGGRCVNTRGSYECYCMDGYLPKGGPVPFHPTRDATLCTEI
DCGTPPEIPGGYIIGNYTSRLGSQVHYACKEGFFSDSEDTVSSCTAMGTWDSPKLNCQEI
DCGHPPEVQHAILEGNHSSRLGSVAHYVCLEGFESPGAKITSVCTEKGTWRASASSCSEI
IVEINEVSVFNNTCVRWQINPGRINSKIEYVIHIKGQRLDPLESVHEETVNLTTESRTPE
VCLDLYQGTNYTVNISTAPPRRSVPAVIEFQTAGDDLLEDDGIFNISIFNDVCLKLNRHS
RKVGSEQVYQFKVLGRRRYLNTFYHATSFNFTTREQTAVVCLDLYPATDYTVNVTLLGSP
EWPSVQTTVTTVPAVQQTISNISIFNETCLRWRSMKTADIEEMYLVHIWGQRWYQKGFAQ
EMIFNITASSQTPETCLDLSPGTNYSVSIQALSSELPVVISLTTQITEPPLPEVDFFTVH
GGPLPRLRLRKAAEKNGPISSYQVLVLPLALQSTFACDSEEAASFFSKASEASGYVTAEL
LAKDIPDDALEISIGDRLYYGKYYNAPLKTGHDYCIILRITSEWNEVRRSACAVWAHVKG
SSLTLSLPQVLGVGLGSVAVVIVLASLSFSAV
Download sequence
Identical sequences W5P9C3
XP_011968724.1.66739 ENSOARP00000007031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]