SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007128 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007128
Domain Number 1 Region: 351-429
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000813
Further Details:      
 
Domain Number 2 Region: 111-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 38-113
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007128
Domain Number - Region: 265-270
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0034
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007128   Gene: ENSOARG00000006655   Transcript: ENSOART00000007235
Sequence length 455
Comment pep:novel chromosome:Oar_v3.1:16:16792356:16794144:1 gene:ENSOARG00000006655 transcript:ENSOART00000007235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEQPEETFPNTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSDFD
CELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPQSTDRVVLIGGKPDRVVE
CIKIILDLISESPIKGRAQPYDPNFYDETYDYGGFTMMFDDRRGRPVGFPMRGRGGFDRM
PPGRGGRPMPPSRRDYDDMSPRRGPPPPPPGRGGRGGSRARNLPLPPPPPPRGGDLMACD
RGRPGDRYNGMVDFSADETWDPDIDTWSPQMAYEPQCGSGYDYSYAGGRGSYGDLGGPII
TTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQ
YLLQNSVKQYSDLLLFKKPTFLCFIGVLHLRWSFF
Download sequence
Identical sequences W5P9L9
ENSOARP00000007128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]