SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007207 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007207
Domain Number 1 Region: 573-692
Classification Level Classification E-value
Superfamily SEA domain 1.96e-18
Family SEA domain 0.0057
Further Details:      
 
Domain Number 2 Region: 233-314
Classification Level Classification E-value
Superfamily SEA domain 0.00000000562
Family SEA domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007207   Gene: ENSOARG00000006728   Transcript: ENSOART00000007315
Sequence length 746
Comment pep:known_by_projection chromosome:Oar_v3.1:8:2667931:2775557:-1 gene:ENSOARG00000006728 transcript:ENSOART00000007315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYMFTRKSIFFKIEEINLSFTDLSIKLYGSEIKDIDNAPRIEATKNTAKTYKVSTMRRIF
DLAKHRTKRSAFFPTGVKVCPQESMEQILASLQAYYRLRVCQEAVWEAYRIFLDRLPEPG
EYQDWVSVCQQETFCLFDIGKNFSNSQEHLDLLQQRVKQRNFLERKDEVVTTEMLGELGQ
TPVSSRDVASVSPRPLPLPTDDTLLNEILNYTLPDTKVPTKERKIEFTDAAEDALEQKVE
LSISLANQKFKPELDNSRSPYYQEVAAKSQLQMQKIFKKLPGFKEIHVSGFRPKKERDGT
SSTEMQLTAIFKKGKAEAKSPASDPPSFDSNKIESEGDPRGTMEEEKQRELYPTASELRK
LISRALEEDQSLDVGTIQFTDAAEIVGSLPSLDPDTQLVLPTLLTVITKDATVSPELPLG
QPRLETVDRAGHSLPGASPTDGSWAPPAMTSTSLSETLPFFTASSVFSQTDQSATDIVSI
DQTVLIPRLTVPTDDYSAISPLVPEISHLPTSSEDRLSTSSQDAMEDLDGMDLTNTPTSS
EVPGFSGHASSPDYVLENITPDPGLHYITTSTMTVAARGRELVVFFSLRVANMPFSTDLF
NKSSLEYQALEQRFTELLVPYLRSNLTGFKQLEILNFRNGSVIVNSKVRFAKSVPYNLTK
AVRGVLEDFRSTAAQRLDLEIDSYSLDVEAADQADPCKFLACGEFAQCVRNEWTEEAECR
CRSGDPGPCVPIEDCEDIPGKGTPCR
Download sequence
Identical sequences W5P9U8
ENSOARP00000007207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]