SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007241 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007241
Domain Number 1 Region: 106-281
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-55
Family F-box associated region, FBA 0.00059
Further Details:      
 
Domain Number 2 Region: 29-146
Classification Level Classification E-value
Superfamily F-box domain 0.000000000196
Family F-box domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007241   Gene: ENSOARG00000006761   Transcript: ENSOART00000007350
Sequence length 282
Comment pep:novel chromosome:Oar_v3.1:1:106289733:106290578:-1 gene:ENSOARG00000006761 transcript:ENSOART00000007350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGPGEETTGASASQGLPACVPASNPESEEAPGLSQLPIEMLLEVLSYLPTSVLLGQCRHV
CRYWRYLVDTRAVWLSILPYSHAKLWPIFRSCLPRDDNDDPRPCLLGRFCERRPLGRNLH
LNPHGIDAFLPWRTVNCRSWRKEESWKDSRRLVPWDSFQPFYRWCYKKQVLDLEEEGLWP
ELLDSGKIEICVSAGWADQEASVCLYELIIQLLDAKQAKLHHFSPRPIHQGTTSIPFKTD
HLFCNLKKGVRFVSLEHWIWDMGFLPEDYGIIMPKASVIVQV
Download sequence
Identical sequences W5P9Y2
ENSOARP00000007241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]