SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007376 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007376
Domain Number 1 Region: 58-238
Classification Level Classification E-value
Superfamily vWA-like 5.7e-39
Family Integrin A (or I) domain 0.00087
Further Details:      
 
Domain Number 2 Region: 1404-1602
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.5e-38
Family Pentraxin (pentaxin) 0.00059
Further Details:      
 
Domain Number 3 Region: 1766-1835
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.64e-19
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 4 Region: 3218-3287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.12e-19
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 5 Region: 2810-2879
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-18
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 6 Region: 2123-2192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-18
Family Complement control module/SCR domain 0.00098
Further Details:      
 
Domain Number 7 Region: 1824-1893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.29e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 8 Region: 2358-2428
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-17
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 9 Region: 2752-2821
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 1940-2008
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 11 Region: 2694-2763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.25e-17
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2868-2937
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 1667-1725
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.00052
Further Details:      
 
Domain Number 14 Region: 2533-2600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 1882-1949
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 16 Region: 2242-2310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000126
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 17 Region: 3276-3343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 3042-3105
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 2417-2486
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 20 Region: 3395-3454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 2651-2705
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 22 Region: 2475-2538
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000417
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 23 Region: 1198-1329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 24 Region: 412-473
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000542
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 25 Region: 1606-1678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 2926-2992
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000931
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 2183-2248
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000005
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 2301-2369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000987
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 29 Region: 3100-3163
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000115
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 30 Region: 2986-3051
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000122
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 3336-3404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 32 Region: 1997-2065
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 33 Region: 355-426
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000347
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 34 Region: 2061-2134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1324-1366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000266
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 36 Region: 1362-1401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000491
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 37 Region: 966-1110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000118
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 38 Region: 3160-3223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000136
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 39 Region: 1173-1210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000287
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 40 Region: 1720-1763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000225
Family EGF-type module 0.033
Further Details:      
 
Domain Number 41 Region: 476-534
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000118
Family Complement control module/SCR domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007376
Domain Number - Region: 256-396,442-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000165
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3446-3482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000193
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 3486-3514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00102
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 707-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00106
Family Complement control module/SCR domain 0.0067
Further Details:      
 
Domain Number - Region: 3514-3544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00157
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007376   Gene: ENSOARG00000006857   Transcript: ENSOART00000007487
Sequence length 3550
Comment pep:known_by_projection chromosome:Oar_v3.1:2:12730845:12925655:1 gene:ENSOARG00000006857 transcript:ENSOART00000007487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWARLAFCCWGLALVSGWATFQQLSPSRNFSFRLFPEAAVERLGQAFRRRVRRLRELSER
LELVFLVDESSSVGQANFLSELKFVRKLLSDFPVVPTATRVAIVTFSSKNNVVPRVDYIS
SRRAHQHKCALLSREIPAITYRGGGTYTKGAFQQAAQILRHSRENSTKVIFLITDGYSNG
GDPRPIAASLRDFGVEIFTFGIWQGNIRELNDMASIPKEEHCYLLHSFEEFEALARRALH
EDLPSGSFIQEDMSHCSYLCEAGKDCCDQMASCKCGTHTGQFECICEKGYYGKGLQYECT
ACPSGTYKPEGSPGGISTCLPCPDENHTSPPGSTSLEDCVCKEGYQASGQTCKVVHCPAL
KPPENGYFIRNTCNNHFNAACGVRCHPGFDLVGSSIFLCLPNGLWSSSESSCRVRTCPRL
RQPKHGRLSCSAGEMSYRTVCLVTCDEGYRLEGSARLTCQVNAQWDGPEPRCVVERHCAT
FQKPKGVTVSPPNCGRHPAKPGTICQLSCRQGFILSGAREEVRCTTSGKWSTKVQTAACK
DVEAPQIICPADIEAETQEQQDSANITWQIPTAKDNSGEKVSIHVHPAFSPPYLFPIGDV
AVTYTATDPSSNQASCTFHIKVIDVEPPSIDWCRSPPPVQVSEKEHAVTWDEPQFSDNSG
AVVTVTRSHTPGDLFPQGETVVRYTATDPSGNNRTCDIHIVVKGSPCEVPFTPVNGDFVC
TQDSTGVNCTLSCLEGYDFTEGSTDKYYCAYEDGIWKPPYSTEWPDCAIKRFANHGYKSF
EMLYKATRCDDTDLLKKFSEAFETTLGKMVPSFCSDADDIDCRLEDLTKKYCLEYNYDYE
NGFAIGPGGWGAANRLDYSYGDFQDTVRETPTGAGKARSSRIERSAPISDHKIRLIFNIT
ASVPLPDERNDTLELENQQRLIKTLETITNQLKRTLAKEPMYSFQLASEMLVVDSNSLET
EKAFLFCRPGSVLRGRMCVNCPLGTYYSLEHSVCESCLMGSYQDEEGQLECKPCPTGTYT
EYLHSRSSSECKAQCKQGTYSSNGLETCESCPLGSYQPAFGSRGCLLCPENTSTVKRGAA
DISACGVPCPVGEFSRSGLMPCYPCPQDYYQPNPGKSFCLSCPFYGTTAITGARSITDCS
SFSSTFSAAEESTVLHSPPGHVKKKYEVSSQVFHECFLNPCHNSGTCQQLGHGYVCLCLP
GYTGLKCEIDIDECSSLPCHNNGICKDRVGEFICECPSGYTGQLCEENVNECSSSPCLNK
GTCVDGLAGYHCTCVKGYMGLHCETEVNECQSSPCLNNAVCEDQLGGFLCKCPPGFLGTR
CDINMDECLSQPCKNGATCKDGANSFRCQCAAGFTGTHCELNVNECQSNPCKNQATCVDE
LNSYSCKCQPGFSGSRCETEQSAGFNLDFEVSGIYGYVMLDGVLPSLHAVTCAFWMKSSD
DINYGTPISYALENGSDNTFLLTDYNGWVLYVNGKEKITDCPSVNDGNWHHIAITWTSTG
GAWKVYIDGKLSDGGMGLSIGSPIPGGGALVIGQEQDEKGEGFNPAESFVGSISQLNLWD
YVLSPQQVNSLATSCPEELSKGNVLAWPDFLSGIVGRVKINPKSIFCSDCPSLEGSVPHL
RTASRDVKPGSKISLFCDPGFQMVGNSVQYCLNQGQWTQPLPRCERISCGVPPPLEHGFY
SAEDFHAGSTVTYQCNNGYYLLGDSRMFCTDNGSWNGISPSCLDVDECAVGSDCSEHASC
LNTNGSYVCSCIPPYTGDGKNCAEPIKCKTPGNPENGHSSGETYTVGAEVTFSCEEGYQL
VGVARITCLESGEWSHLIPYCEAVSCGAPALPENGGVDGSAFTYGNKVIYRCNKGYTLEG
EKESSCLASGSWSHSPPVCELVKCSSPEDVNHGNYILSGLTYLSTASYSCDNGYSLQGPS
VIECSASGSWDRAPPTCHLVSCGEPPAIKDAVTTGSNFTFGNTVTYACREGYTLAGPDTI
ECLASGKWSRSDQQCLAVSCDEPPSVEHASPETAHRLFGDIAFYYCSDGYSLADNSQLLC
NAQGKWVPPEGQAMPRCIAHFCEKPPAVSYSILESVSKAKFAAGSVVSFKCMEGFVLNTS
AKIECLRGGQWSPSPMSIQCIPVRCGEPPRIMNGYAIGSNYSFGAMVAYSCNRGFYIKGE
KKSACEATGQWSSPTPTCHPVSCSEPPKVENGFLEHTTGRTFESEVRYQCNPGYKSVGSP
VFVCQANRHWHSESPLSCIPLNCGKPPPIQNGYIKGENFEVGAKVHFFCNEGYELIGDHS
WTCLKSGKWSKKPNQKCVPAKCPEPPLLENQLVLKELTTEVGVVTFSCKEGHVLQGRSVL
RCLPSQQWNDSFPVCKMVLCRPPPLISFGVPAPSSALHFGSTVKYSCVDGFFLKGDPTTS
CQADGTWSSPLPECVPVECPQPEEILNGIIDVQGLAYLSTALYTCKPGFELVGNTTTLCG
ENGHWLGKKPTCKPIECSKPKEILNGKFSYTKLHYGQTITYSCDQGFRLEGPKALTCLET
GDWDVDVPSCNAIHCDPPQPIENGFVEGADYSYGAMIIYSCFPGFQVAGHTMQTCEESGW
SSSIPTCVPIDCGLPPHIDFGDSTVVRDGQGYFNQEDDMMEVPHVTPHPPHHLGTVAKIW
GNTKGSPAMHSAKFRYNTLVSYSCNPGYELLGNAVLICQEDGTWNGSAPSCISIECDLPV
APENGFLHVTETTTGSAVQYSCKPGHTLVGSDIRLCLRNREWSGASPRCEVISCPKPNPV
TDGSIQGSTYSYLSVLYYECNSGYVLNGTSRRTCQEDKTWDGDEPVCIPVDCGSPPSSAN
GQIKGEEYTFQKEVQYTCNTGFLLEGASSRVCLADGSWSGNTPTCVPVRCAPPSQVENGV
MDGLDYGFGKEVVFHCQDGYALHGAPKLTCQSDGNWDAQVPVCKPVNCSPPEDLDRGFPN
GFSFYRGGQIEYQCFPGYKLHGSPSRKCLSNSSWSGSPPSCLPCKCSPPTIQSGAVNGTD
VSCGKAAQIRCFKGFQLLGLSEITCEADGQWSSDFPRCEHLSCGSPPTIPNAFIIERGSL
EENVITYACKPGYVIQGSSDLICTEKGTWSQPYPVCEPLSCGPPPSVSNAVATGESYTYE
SQVKLRCLEGYMMDTDIDTFTCQKDGRWVPELISCSPKKCPLPTNVTHILVHGDDFSVNK
QVSVSCAEGYTYEGVNISTCQLDGTWEPPFSDESCSPISCGKPESPEHGFVFGSEYNFES
TITYHCETGYELEGNRERVCQENGQWTGEVATCKKIMCEAPLEFLNGKAEVENSTTGPSV
IYSCNRGYSLEGAPEASCTENGTWSHPVPLCKPNPCPVPFVIPENAVLSEKEFYVDQNVS
IKCREGFLLRGQSTITCNPDETWTQTSAKCEKISCGPPTHVENAIARGVHYQYGDMITYS
CYSGYMLEGSLRSVCLENGTWTSPPVCRAVCRFPCQNGGICQRPNACSCPDGWMGRLCEE
PICILPCLNGGRCVAPYQCDCSPGWTGSRCHTAVCQSPCLNGGKCVRPNRCHCLSAWTGH
DCSSMRRLKF
Download sequence
Identical sequences W5PAB7
ENSOARP00000007376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]