SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007393 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007393
Domain Number 1 Region: 523-555,637-711
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007393   Gene: ENSOARG00000006903   Transcript: ENSOART00000007504
Sequence length 760
Comment pep:known chromosome:Oar_v3.1:4:48795383:48821011:-1 gene:ENSOARG00000006903 transcript:ENSOART00000007504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPIGNQYVVARPVYSANAFGEEHKKKQRHHKTLLDHLKKLCRCSAQKAKNIAFSLFPI
ASWLPAYRIKEWLLSDIVSGVSTGLVAVLQGLAFALLVTIPPGYGLYAAFFPVIIYFFLG
TSRHISVGPFPVLSMMVGAVVVRLTATDNTADSTFTNSSMTNDSSIDEQKVIVAATVTML
SGIIQLLMGVLRLGFVVIYLSESLISGFTTAAAIHVVVSQLKFMFQLTVPAHTDPFSLFK
VLESVFSQIEKTNIADLVTSLVILVVVFVVKELNQRYKAKLPVPIPIELIVTVIATGVSY
GFDFKTRFNVAVIGEMKPGFQAPVTPSRQTFQDTIGDSFGIAIVGFAVAFSVASVYSLKY
DYPIDGNQELIALGASNIFGGSFKGFAASTSLSRSGVQESTGGKTQIAGLLSAIIVLIVI
VAIGFLLEPLQKSVLAALALGNLKGMLMQFAEIRRLWRKDKYDCLIWVMTFIFAVVLGLG
LGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNRKDYSEIYEPEGVKIFRCPSPIY
FANISFFKQKLIDAIGFRPLRILRKRNKALKKIRKMQKKGLLQVTPKGFICTVDGFKDSD
EELDNDKIEELDQPINTTDLPFQIDWNANLPLNIVVPKINLHSLILDFSAVSFLDVSSMR
GLKTILQEFIRIQVDVYIAGTDDDFIEKLTRCEFFDDEVKDSIFFLTIHDAVLHILMKKD
YSTSKFNPSQEVEAKSDDFTISTNGGLRNRECQVPIETKF
Download sequence
Identical sequences W5PAD4
ENSOARP00000007393 XP_012031635.1.66739 XP_012031636.1.66739 XP_012031637.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]