SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007500 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007500
Domain Number 1 Region: 105-213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-36
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 2 Region: 216-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-34
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 3 Region: 4-101
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-27
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007500   Gene: ENSOARG00000006998   Transcript: ENSOART00000007612
Sequence length 488
Comment pep:known_by_projection chromosome:Oar_v3.1:1:28396091:28408152:-1 gene:ENSOARG00000006998 transcript:ENSOART00000007612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVKCGGVLSAPSGNFSSPNFPRLYPYNTECSWLIVVAEGSSVLLTFHAFDLEYHDTCGFD
FLEIYNGASGDQGNLLGRWARGAVFHSDKHVASHGFSAGYQKDVCGGVLTGLSGVLVSPE
YPNNYPNNAECHWVIRAAGPATVKLVFVDFQMEGSEQCTYDYVAVLEGPGPTQGHHYCGS
ARPPTLVSLGHELQVVFKSDFNIGGRGFKAYYFSGECQEEYTAVQGNFSSPQYPSPYPNN
LRCHWTIRLPPGYRVKVFFLDLELEEPSSLTRTCDFDHLAAFDGASEEAPLLGNWCGHHL
PPPVTSSHNQLLIVLRTDRSTTRRGFSVAYIGVVPMNVSCSRTDFQILISAQALAPLERT
KVYLGSRSCAAQEMGSNFRIQARFDTCGTESQRRNNTSVIVSVLYIDFSAGGQEDTHEYE
VRCEPRRKEASVHLLSGSRWLGPSGDEAEALEGPVAMVAQDTSDVVFLGLCILAGVLMVV
AIVVLMLL
Download sequence
Identical sequences W5PAN9
ENSOARP00000007500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]