SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007547 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007547
Domain Number 1 Region: 36-160
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-56
Family The laminin-binding domain of agrin 0.000000476
Further Details:      
 
Domain Number 2 Region: 1347-1553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-44
Family Laminin G-like module 0.00031
Further Details:      
 
Domain Number 3 Region: 1835-2041
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.4e-38
Family Laminin G-like module 0.000000286
Further Details:      
 
Domain Number 4 Region: 1604-1804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.29e-31
Family Laminin G-like module 0.00054
Further Details:      
 
Domain Number 5 Region: 468-535
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 2.08e-16
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 6 Region: 551-600
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000166
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 7 Region: 901-970
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000018
Family Ovomucoid domain III-like 0.0073
Further Details:      
 
Domain Number 8 Region: 1145-1220
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000209
Family SEA domain 0.0028
Further Details:      
 
Domain Number 9 Region: 700-750
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000222
Family Ovomucoid domain III-like 0.0017
Further Details:      
 
Domain Number 10 Region: 618-665
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000036
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 11 Region: 248-318
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000416
Family Ovomucoid domain III-like 0.0077
Further Details:      
 
Domain Number 12 Region: 341-390
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000119
Family Ovomucoid domain III-like 0.0092
Further Details:      
 
Domain Number 13 Region: 793-836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000165
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 14 Region: 847-884
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000248
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 15 Region: 1547-1592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007547
Domain Number - Region: 175-213
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0621
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007547   Gene: ENSOARG00000007039   Transcript: ENSOART00000007660
Sequence length 2043
Comment pep:novel chromosome:Oar_v3.1:12:49496678:49535503:-1 gene:ENSOARG00000007039 transcript:ENSOART00000007660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLRPFSRALLQPLLLLLVVAVRALPSADGTCPERALERREEEANVVLTGTVEEILNVDPV
QHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVNPA
PPYLWPAHKNELMLNSSLMRITLRNLEEVEHCVEDKPGTHFTPVPPTPPDACRGMLCGFG
AVCEPSADEPGRASCVCKKSACPSVVAPECGSDASPTENEREWQRGPGTPQPAVRGVAKG
WAGTRDPCSNVTCSFGSTCVPSADGLTATCLCPATCLGAPERPVCGSDGSDYPSECQLLR
QACAHQENVFKKFDGPCDPCQGSLSDLSRTCRVNPRTRQPEMLLRPESCPPRGTPVCGDD
GVTYDNDCVMGRTGAARGLLLQKVRSGQCQPQDQCPEPCRFNAVCLSTRARVEVGCSAWG
DVGSKAGVCGQGPGTSVGPEWAETACPVCTGALPTSHSVPVNQPPSPCRGVQCPFGATCT
VKNGEAECACHQVCSGVYDPVCGSDGVTYGSVCELEASACALRREIRVARRGPCDRCGQC
RFGALCEAETGRCVCPSECVASAQPVCGSDGRTYANECELHVHACTRQISLHVASASPCQ
TCGDTVCAFGAVCSAGQCMCPRCERPPPGPVCGSDGVTYGSSCELREAACQQQTQIEEAR
VGPCEQAECGSGGSGSGEDGECEPELCRQRGGIWDEDSEDGPCVCGFSCQGVLRSPVCGS
DGVTYRTECELKKARCESQPELYVVAQGACRGPTLAPLPPAIPLHCAQTPYGCCQDNITV
AQGVGLAGCPSSCQCNPHGSYGGTCDPVTGQCSCRPGVGGLKCDRCEPGFWNFRGIVTDG
RSGCTPCSCDPRGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCETDSSQPTT
CAEMLCEFGASCVEEAGSAHCVCPTPTCPAADATKVCGSDGVTYGNECQLRTIACRQGLE
ISIQSFGPCQEGITSGPHQTSASVAPLALDLNKAPLLPPSALPLAPSSTRHSQPTARASS
QPWTMASIPRTTARPVLTMPPMAPSPAASLVTSAFGESGSADGSGDEELSGDLEASGTGS
GGLESPERDSAGTPGLPMERASCYNSPMGCCYGKTPSLDAEGSNCPATKAFQGVLELEGV
EGQELFYTPEMADPKSELFGETARSIESALDDLFRNSDVKKDFRSVRLRDLGPGSSVRAI
VEVHFDPTTAFRASDVGRALLRQLQVSRRRSLGVKRPLQEHVRFMDFDWFPAFFTGATPA
AATARATTVARLPPSAATPRAHFPSHTSRPVSRTTPPLTTRQPPTTAPSRVPGRRPLPPG
TQQPRRPCDSQPCLHGGTCQDQGSGADFTCSCPAGTEGAVCEKALHPSVPAFGGSSFLAF
PTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLGLALLGGRVQFRFDTGSGPAVLTS
SVPVQPGQWHRLELSRHWRQGTLSVDGETPVLGQSPSGTDGLNLDTDLFVGGVPEDQAST
VLERTSVSVGLRGCIRLLDVNNQRLELSSWPESATRNSGVGECGDHPCLPSPCLGGAPCQ
ALEAGRFRCQCPPGRFGPTCADEDPCQPNPCHGAAPCRVLPQGEAKCECPHGREGSLCQT
VSEPEDNQPFLADFSSFSYLELKGLHTFERDLGEKMALEVVFLARSPSGLLLYNGQKTDG
KGDFVSLALHNGLLEFRYDLGKGAAVIRSKEPVALGAWTRVSLERNGRKGAMRVGDGPRV
LGESPKSRKVPHTVLNLKEPLFVGGAPDFSKLARAAAVSSGFDGAIQLVSLNGRQLLTRE
HVVRAMDVSSFADHPCTQAEGQPCLHGASCLPREASYECLCPAGFSGLHCEKGLIEKSAG
DLDALAFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYIALA
IVDGRLQLAYDLGSQPVVLRSTVPVNTNRWLRIRAHRKQREGSLQVGNEAPVTGSSPLGA
TQLDTDGALWLGGLGKLPTGQALPKAYGTGFVGCLRDVVVGQRPLHLLEDAITKPELRPC
PAL
Download sequence
Identical sequences W5PAT6
ENSOARP00000007547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]