SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007615 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007615
Domain Number 1 Region: 141-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.23e-121
Family Transglutaminase core 0.0000000000744
Further Details:      
 
Domain Number 2 Region: 4-138
Classification Level Classification E-value
Superfamily E set domains 1.29e-43
Family Transglutaminase N-terminal domain 0.00000784
Further Details:      
 
Domain Number 3 Region: 480-592
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.57e-29
Family Transglutaminase, two C-terminal domains 0.00000192
Further Details:      
 
Domain Number 4 Region: 592-690
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.96e-26
Family Transglutaminase, two C-terminal domains 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007615   Gene: ENSOARG00000007100   Transcript: ENSOART00000007728
Sequence length 691
Comment pep:known_by_projection chromosome:Oar_v3.1:13:52130353:52173973:-1 gene:ENSOARG00000007100 transcript:ENSOART00000007728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLQGVNWQTASNRQAHHTDRFYSQDLIVRRGQPFHMSVTLSRGLSSGGSVTFTVSTGP
YPSESAKTKAVFPLSNGTSSSGWGAQLVSNRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSMLKLGTFILLFNPWLQADGVFMSNHAEREEYVQEDAGIIFVGSTNRIGMIGWNYGQF
EEGILNICLSVLDNSLNFHRDPATDVAHRNDPKYIGRVLSAMINANDDNGVISGNWSGSY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDRNLSVDVYYDPLGRPVEKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESSGALKKNSSDTHSVGKY
ISTKAVGSNSRVDVTEKYKYPEGSSQERQVFEKALRKLKPRVSFSATSASSLARDEPEPS
ISGRFKVAGVLAVGKEVNLVLILKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKITYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDVILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGSLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
Download sequence
Identical sequences W5PB04
ENSOARP00000007615 XP_004014440.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]