SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007672 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007672
Domain Number 1 Region: 4-83
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.4e-22
Family Hypothetical protein AT3g04780/F7O18 27 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007672   Gene: ENSOARG00000007158   Transcript: ENSOART00000007787
Sequence length 118
Comment pep:novel chromosome:Oar_v3.1:2:242013423:242021512:-1 gene:ENSOARG00000007158 transcript:ENSOART00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEDDDSHPSEMRLYKNIPQMSFDDTDREPDQTFSLNRDLTGELEYATKISRFSNVYHLS
IHISKNFGADTTKVFYIGLRGEWTELRRHEVTICNYEASANPADHKVHQVTPQTHFIS
Download sequence
Identical sequences W5PB61
XP_005905225.1.15283 XP_005955882.1.78601 ENSOARP00000007672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]