SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007717 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007717
Domain Number 1 Region: 705-760
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000051
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 2 Region: 762-810
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000116
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 3 Region: 649-705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000183
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 596-646
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 849-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 538-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007717   Gene: ENSOARG00000007202   Transcript: ENSOART00000007832
Sequence length 902
Comment pep:known_by_projection chromosome:Oar_v3.1:15:38044689:38354554:-1 gene:ENSOARG00000007202 transcript:ENSOART00000007832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSLDPGNSASQNKHHRAANRQLRNKTALRWGSGQNQPSLLLLLLRRRPPFLALLGELR
SPPGLCQVSFPRGPLRAGVVWREPAARAQSWGPARMRLSPVLLRLSRGPALLALALPLAV
ALAFSDETLDKVPKSEGYCSRILRVQGTRREGYTEFSLRVEGDPDFYKPGTSHRVTLSAA
PPSYFRGFTLIALKENREGDKEEDHAGTFQIIDEEETQFMSNCPVAVTESTPRRRTRIQV
FWIAPPAGTGCVILKASIVQKRIIYFQDEGSLTKKLCEQDSTFDGVTDKPILDCCACGTA
KYRLTFYGNWSEKTHPKDYPRRANHWSAIIGGSHSKNYVLWEYGGYASEGVKQVAELGSP
VKMEEEIRQQSDEVLTVIKAKAQWPAWQPLNVRAAPSAEFSVDRTRHLMSFLTMMGPSPD
WNVGLSAEDLCTKECGWVQKVVQDLIPWDAGTDSGVTYESPNKPTIPQEKIRPLTSLDHP
QSPFYDPEGGSITQVARVVIERIARKGEQCNIVPDNVDDIVADLAPEEKDEDDTPETCIY
SNWSPWSACSSSTCDKGKRMRQRMLKAQLDLSVPCPDTQDFQPCMGPGCSDEDGSTCTMS
EWITWSPCSISCGAGMRSRERYVKQFPEDGSVCTLPTEETEKCTVNEECSPSSCLTTEWG
EWDECSATCGMGMKKRHRMVKMSPADGSMCKAETSQAEKCMMPECHTIPCLLSLWSEWSD
CSVTCGKGMRTRQRMLKSLAELGDCNEELEQVEKCMLPECPIDCELTEWSQWSECNKSCG
KGHMIRTRMIQMEPQFGGAPCPETVQRKKCRIRKCLRNPSLQNLRWREARESRRSEQLRE
ESDGDQFPGCRMRPWTAWSECTKLCGGGIQERYMTVKKRFKSSQFTSCKDKKEIRACNVH
PC
Download sequence
Identical sequences W5PBA6
ENSOARP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]