SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007757 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007757
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.15e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007757
Domain Number - Region: 552-612
Classification Level Classification E-value
Superfamily F-box domain 0.0216
Family F-box domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007757   Gene: ENSOARG00000007237   Transcript: ENSOART00000007872
Sequence length 753
Comment pep:known_by_projection chromosome:Oar_v3.1:2:242032654:242045120:-1 gene:ENSOARG00000007237 transcript:ENSOART00000007872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKYLKKLSALPITVDILAETGVGKTVNSLRKHEHVGNFARDLVAQWKKLVPVERTTEP
EEQNFEKSSSRKRPRDALREEAEIEGDYPESWKASSSQSYSPDNRQKKHRKLPELERPHK
VSHSHGRRDERKRYHRASPVYSSDHESSDYGHVQSPPPSASPHHMSLDHYRSLEEDHEPF
VPHQKPGKGHGNTFQDRLGVSQERHVGEAQGRESASQSKEHRSSHKERRPVDAKGDEKAS
LSKEKSHKVVSKEENRRPTSGDSTKEKLPSGVRKEKEKEKEGSAKKKVLPPLEVASDNHL
KKPKPRDSEKTRSDKNKQSLENSDVGKGAGDLLPKAKEKVSNNLKTQEGKVKPSHSDRKS
VASFPKGEEADTDDEFEKPTMSFESYLSYDQPRKKKKKVVKTSTTTPGEKGLKKNDSKST
SKNLDSVQKLPKVNENKPEKLLPVGADSAKLKKVPSDVLPVLPDLPLPVIQANYRPLPSP
ELMSSFQPKRKALSSPQEEEEAGFTGRRMNSKMQVYSGSKCAYLPKMMTLHEQCIRVLKN
NIDSIFEVGGVPYSVLEPVLERCTPDQLYRIEEYNHVLIEETDQLWKVHCHRDFKDERPE
EYESWREMYLRLQDAREQRLRVLTKNIRSAHANKPKGRQAKMAFVNSVAKPPRDVRRRQE
KFGTGGAAVPEKIRIKPAPYPTGSSRASFSSHWTSITPSPEEPAYDGPSTSGAHPAPVVS
STVSYDPRKPAVKKIAPMMAKTIKAFKNRFSRR
Download sequence
Identical sequences W5PBE6
ENSOARP00000007757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]