SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007761 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007761
Domain Number 1 Region: 260-521
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-87
Family Protein kinases, catalytic subunit 0.000000000204
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000007761
Domain Number - Region: 79-181
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0562
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007761   Gene: ENSOARG00000007238   Transcript: ENSOART00000007877
Sequence length 544
Comment pep:known_by_projection chromosome:Oar_v3.1:21:17994065:18071164:1 gene:ENSOARG00000007238 transcript:ENSOART00000007877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRAILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKAVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPITPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
Download sequence
Identical sequences W5PBF0
ENSOARP00000007761 XP_004019485.1.66739 XP_005699559.2.57651 XP_011957105.1.66739 XP_011957106.1.66739 XP_011957107.1.66739 XP_011957108.1.66739 XP_012019404.1.54773 XP_012019405.1.54773 XP_012019406.1.54773 XP_012019408.1.54773 XP_012019409.1.54773 XP_012019410.1.54773 XP_013831235.2.57651 XP_017898884.1.57651 XP_017898885.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]