SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007776 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007776
Domain Number 1 Region: 194-431
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.44e-52
Family Regulator of chromosome condensation RCC1 0.0062
Further Details:      
 
Domain Number 2 Region: 826-931
Classification Level Classification E-value
Superfamily POZ domain 1.61e-20
Family BTB/POZ domain 0.0085
Further Details:      
 
Domain Number 3 Region: 96-190
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.29e-20
Family Ankyrin repeat 0.00098
Further Details:      
 
Domain Number 4 Region: 602-705
Classification Level Classification E-value
Superfamily POZ domain 3.92e-16
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007776   Gene: ENSOARG00000007250   Transcript: ENSOART00000007892
Sequence length 1415
Comment pep:known_by_projection chromosome:Oar_v3.1:8:9173895:9261065:-1 gene:ENSOARG00000007250 transcript:ENSOART00000007892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKYIVQTYIVLYCCQEDLNYNPKQAIYSLSVFLNSSSVAWLFHFFKLSDYSEEGSCIKT
IRMSSSIPDCTSKCRSLTHALDVLSVVTKGSENQIKAFLSSHCYNAATIKDAFGRNALHL
VASCGKKGVLDWLIEKGVDPLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVNLYIQDKE
GLSALDLVMKDRPTHVVFKNTDPTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIY
IKQVVLCKFHSVFLSQKGQVYTCGHGPGGRLGHGDEQTCLVPRLVEGLSGHNCSQVAAAK
DHTVVLTEDGYVYTFGLNIFHQLGLIPPPSSCNVPRQMQAKYLKGRTIIGVAAGRFHTVL
WTREAVYTMGLNGGQLGYLLDPNGEKCVTAPRQVSALHHKDITLSLVAASDGATVCVTAK
GDIYLLADYQCKKLASKQLNLKKVLVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVF
CWRSVNSSMKQCRWAYPRQVFISDIALSRNEILFVTRDGEGFRGKWFEEKRKSSEKKAEI
LSNLHNSSPDVSCVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAVLQSDPKTSLYE
IPTVSSSSFFEEFGKLLRETDEMDNIHDVTFQVGSRLFPAHKYILAVRSDFFQKLFLSDG
TALDFTDVYRKDEDSAGCHLFVVEKVHPDLFEYLLQFIYTDTCDFLTHGFKPRLNLNRKP
EGYPGTPNCHSNKMSSHEDNQKSAFEVYKSNQAHTISEKQKSKSKSSKKVKSVGEDDPVK
LLQNVAKKFGFSNLSSRLDGVRYENEEISIIAKKTGSKPKLNQKKCSFLCDVTMKSVDGK
EFPCHKCVLCARLEYFHSMLSSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKES
QNVDFVCSVLVVADQLLISRLKEICEVALTEKLTLKNAAMLLEFAAVYNAEQLKLSCLQF
IGLNMAALLEARSLDVLSDGVLKDLSVFYRKMIPAMERRVITPYQDGPDISYLDVEDGDI
FLKEEVNMEQNYSESIVKKTKTKAKKKPRKRSDSSGGYNLSDIIQSPPSTGLLKSGKTNS
VESLPELLTSDSEGSYAGVGSPRDLQSPDFTTGFHSDKSEGKIKSYVNGTPPAYFREDLK
PWEKSPVLKITAPQPIPSNRIDTTSSSSWVSGSFSPVSPPVMDLRTIMQIEESRQKCGTT
PKTNLGKMISHGVKLSQKQRKMIAMTTKDNNSGMNNMETALSAPSKSPKPANAWASSQHS
VSSKSFRDFSVEEKKSVIGQSSGDHVKKVCFKGIESSQSPKVVRCSAHGSPGREGNRVSD
VPLPDSPNPWLSSSLTAPSVAAPVTFASIVEEELQQEAALIRSREKPLALIQIEERAIQD
LLVFYEAFGNPDEFVIVERTPQGPLAVPMWNKHGC
Download sequence
Identical sequences W5PBG5
ENSOARP00000007776 XP_012037839.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]