SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007792 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007792
Domain Number 1 Region: 33-207
Classification Level Classification E-value
Superfamily TIMP-like 6.08e-35
Family Tissue inhibitor of metalloproteinases, TIMP 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007792   Gene: ENSOARG00000007273   Transcript: ENSOART00000007909
Sequence length 227
Comment pep:novel chromosome:Oar_v3.1:14:3750008:3751757:1 gene:ENSOARG00000007273 transcript:ENSOART00000007909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HTSAQPNRGTTMGPAFLLVFPLLLVLSTPCDACECKMQHPQTFYCISDVVIIGNILGRGN
DTALKRSYRINVTQILKFPKKNAPITSIYTPKDWDSCGYEVRTSQQSQLLLAGYLRNGAL
YFTRCHLVYFWYRLTDEQRLGFQALYKRGCRCQIQPCLLCWRHCPEPDNQQCVWEQKGCN
YKIWEGDQSLYSMCAPRHDGHCGWTRIDTVNYHPETTPPPETTPEMM
Download sequence
Identical sequences W5PBI1
ENSOARP00000007792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]