SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000007941 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000007941
Domain Number 1 Region: 125-197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.07e-17
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 2 Region: 187-249
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-16
Family Complement control module/SCR domain 0.00024
Further Details:      
 
Domain Number 3 Region: 443-506
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000418
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 248-313
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.00084
Further Details:      
 
Domain Number 5 Region: 64-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000702
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 501-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000306
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 329-385
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000148
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 8 Region: 381-447
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000432
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000007941   Gene: ENSOARG00000007405   Transcript: ENSOART00000008058
Sequence length 613
Comment pep:known_by_projection chromosome:Oar_v3.1:12:4210173:4269729:1 gene:ENSOARG00000007405 transcript:ENSOART00000008058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIESSSSAVCRKVSMKHQRVPVMILHSKGTMASWPFSRLWSISDPILFQVTLVATLLATV
LGSCGIPPYLDFAYPINELNETTFETGTTLRYKCRPGYTMSSKSYFLICKATGNWNYREF
CVKKRCGNPGELLNGQVIVKTDYSFGSEIEFSCSEGYILIGSANSYCEIQDKGVGWSDPL
PQCLIAKCKPPPTISNGRHNGGDEDFYTFGSSVTYSCDPDFSMLGKASISCRVQNKTIGV
WSPSPPSCKKVICVQPVVKDGKITSGFGPIYTYQQSIVYACNKGFRLEGSNVIRCEADNS
WSPPPPTCELNGCVGLPHIPHASWGRYGYQTQTKHEVYDIGTVLSYNCHFGYKPEADGPR
TVTCQSNLKWSPYIECKEVCCPVPNLNNDGSITLRRRLSNSTHCIYFSGDEISYECHNKY
RLDATCTKYGTWNPRTPECSPDCESPPVIAHGRHKIVSKGSWYQHEEVEYECDEGYILDG
AKRLSCTSSGWSPAVPQCKARCVKPEIEYGKLSVEKVRYVEPERITIQCESGYSLVGSEN
ITCSEDRTWYPEAPKCEWEYPEGCEQVITGRKLLQCLPRPEEVKLALEVYKLSLEIELLH
TEKLKKSSEEEFL
Download sequence
Identical sequences W5PBY0
ENSOARP00000007941 XP_004013628.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]