SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008291 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008291
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.89e-17
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 114-169
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008291   Gene: ENSOARG00000007731   Transcript: ENSOART00000008414
Sequence length 241
Comment pep:known_by_projection chromosome:Oar_v3.1:8:11210668:11265163:-1 gene:ENSOARG00000007731 transcript:ENSOART00000008414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHPNVSQGCQGGCATCSDYNGCLSCKPKLFFVLERIGMKQIGVCLSSCPSGYYGTRYPDI
NKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEASE
WSPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTSEARKCTVQRKKCPKGERG
RKGRERKRKKPSKEESKDAIPDNKGLEPSRETPEQRENKQQQKKRKVQDKQQKSVSVSTV
H
Download sequence
Identical sequences W5PCX9
ENSOARP00000008291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]