SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008444 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008444
Domain Number 1 Region: 33-227
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.2e-58
Family Astacin 0.0000921
Further Details:      
 
Domain Number 2 Region: 499-609
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-37
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 343-452
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-36
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 660-766
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-36
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 5 Region: 234-343
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-35
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 6 Region: 768-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-20
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 7 Region: 610-653
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000153
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 454-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000623
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008444   Gene: ENSOARG00000007861   Transcript: ENSOART00000008567
Sequence length 896
Comment pep:known_by_projection chromosome:Oar_v3.1:22:16929788:16989004:-1 gene:ENSOARG00000007861 transcript:ENSOART00000008567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGKENTLLPQSPGTLHAGAETFPPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFK
QAMRHWEKHTCVTFIERTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVA
HELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGEMYDFDSIMHY
ARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTMGN
FSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPL
LGRFCGDKVPEALVSTDSRLWVEFRSSSNILGKGFFAVYEATCGGDINKDAGQIQSPNYP
DDYRPSKECVWRITVSEGYHVGLTFQAFEIERHDSCAYDYLEIRDGFTEDSALIGHFCGY
EKPDDVKSSSNRMWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEQRCLNTLGSYKC
MCDPGYELAADKKACEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQ
FEVFELEGNDVCKYDFVEVRSGLSPDARLHGKFCGSETPEVITSQSNNMRVEFKSDNTVS
KRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYRLHENGQDCKEAGCVHKIS
SAEGSLVSPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLELYDGPD
SQAPVLGRFCGSKKPDPVVASGSSLFLRFYSDASVQRRGFQAVHSTECGGRLKAEVQSKE
LYSHAQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDYMEAAVTAGTQS
MNPPGFPFSPPQPLEEIYSAGDSLMIRFHTDDTINKKGFHARYTSTKFQDALHMKK
Download sequence
Identical sequences W5PDD2
ENSOARP00000008444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]