SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008556 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008556
Domain Number 1 Region: 154-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.03e-16
Family Complement control module/SCR domain 0.00022
Further Details:      
 
Domain Number 2 Region: 215-276
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000183
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 3 Region: 90-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 4 Region: 28-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000764
Family Complement control module/SCR domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008556   Gene: ENSOARG00000007971   Transcript: ENSOART00000008680
Sequence length 547
Comment pep:known_by_projection chromosome:Oar_v3.1:12:4582491:4601032:1 gene:ENSOARG00000007971 transcript:ENSOART00000008680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPPLPRPAPGVRKALAHSSLSQSFGDCSLPPDVPNAQATLGGLTSFPEQRTVTYKCNK
GFVKVPGKADSVVCQNNKWSELAEFCNRSCDVPTRLLFASLKKSYSQQNYFPEGSTVEYE
CRQGYIRDPSLSGNITCLQNFVWSKPDKFCKKKSCPKPREIENGHVKITTDILLGATIYF
SCNTGYKLVGAASSFCAPMGNTVGWSAGFPECQKILCPEPPKVDHGMIQEKQNSYAYGQS
ATYKCMEGFTLHGEISIYCTVRDDQGEWSGPLPQCRETDVSPTVLKSTEVNVPGTKVLST
PQKPTTVNVSATETPSTPQKPTTVNVSAIETPPTPQKPTTKPTAVNVPGTETPPTPQKLI
TINSSATKPPLVSQTYTTVNVPATKVPSPPQKPTTANGSATTAWNSPISNTVSTAAQNPI
MPNASATTPTTQRFTSAKSLLTQNLKATQKSTSVHTTKGLRITQRLTSARVTAAKSTAVP
RTTLRLHATSAPKGRGSAPSVASTIASGKCGSLRVRRICHRFWIYNSWKRILSEYKMLCC
CRHETKN
Download sequence
Identical sequences W5PDP2
ENSOARP00000008556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]