SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008579 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008579
Domain Number 1 Region: 542-587
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000471
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 71-145,196-209,495-537
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000615
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008579   Gene: ENSOARG00000007993   Transcript: ENSOART00000008704
Sequence length 587
Comment pep:known_by_projection chromosome:Oar_v3.1:1:31200958:31272287:1 gene:ENSOARG00000007993 transcript:ENSOART00000008704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAAFFLLFLMTCQPGVTIQEKVNWRVSRAVESFTPTAVSCQLDNWAEWTDCFPCQDKK
YRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNG
DQDCLDGSDEDDCEDFRIPENDCSQYDPIPGSERAALGYNILTQEETQNVYDARYYGGQC
ETVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEALADTKFSSEKYNDVNDLL
TKVKNDNSVSKGLTVGVSSTRNPVMVTIGVSTSQDASFLKKLSKYNEKKYIFMRIFTKVQ
TAHFKMRRENIMLDEGMQQSLMELPEQYHYGIYAKFINDYGTHYITSGSMGGVYEYILVL
NREKMETAGITSTEIKRCFGVSLGIEYSEKIQTRGSLSLGPCEKSGDGKLTEDQKAMGME
DFISRVRGGSSGWGGGLTQESSIITYRSWGRSLKYNPAVIDFEIRPIHEILRHTNLGSLE
TKRQNLRRALDQYLMEFNACRCGPCFNNGEPILEGTSCKCLCPVGRQGLACEQMQSEGAK
ADGHWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQAC
Download sequence
Identical sequences W5PDR5
ENSOARP00000008579 XP_004002064.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]