SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008581 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008581
Domain Number 1 Region: 497-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000419
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Domain Number 2 Region: 101-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000576
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 40-88
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000562
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008581   Gene: ENSOARG00000007993   Transcript: ENSOART00000008706
Sequence length 542
Comment pep:known_by_projection chromosome:Oar_v3.1:1:31200958:31272287:1 gene:ENSOARG00000007993 transcript:ENSOART00000008706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFAAAFFLLFLMTCQPGVTIQEKVNWRVSRAVESFTPTAVSCQLDNWAEWTDCFPCQDKK
YRYRSLLQPNKFGGTICSGNVWDQASCHSPTACLSQAQCGQDFQCKETGRCLKRHLVCNG
DQDCLDGSDEDDCEDFRIPENDCSQYDPIPGSERAALGYNILTQEETQNVYDARYYGGQC
ETVYNGEWRELQYDPACERLYYGDDDKYFRKPYNFLKYHFEALADTKFSSEKYNDVNDLL
TKVKNDNSVSKGLTVGVSSTRNPVMVTIGVSTSQDASFLKKLSKYNEKKYIFMRIFTKVQ
TAHFKMRRENIMLDEGMQQSLMELPEQYHYGIYAKFINDYGTHYITSGSMGGVYEYILVL
NREKMETAGITSTEIKRCFGVSLGIEYSEKIQTRGSLSLGPCEKSGDGKLTEDQKAMGME
DFISRVRGGSSGWGGGLTQESSIITYRSWGRSLKYNPAVIDFEIRPIHEILRHTNLGSLE
TKRLACEQMQSEGAKADGHWSCWSSWSACRSGTQERRRECNNPAPQNGGASCPGHRVQTQ
AC
Download sequence
Identical sequences W5PDR7
ENSOARP00000008581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]