SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008704 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008704
Domain Number 1 Region: 481-843
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.62e-102
Family Oxysterol-binding protein 0.004
Further Details:      
 
Domain Number 2 Region: 50-144
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-17
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008704   Gene: ENSOARG00000008101   Transcript: ENSOART00000008831
Sequence length 848
Comment pep:known_by_projection chromosome:Oar_v3.1:11:38193290:38202467:1 gene:ENSOARG00000008101 transcript:ENSOART00000008831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQEWDPPSLAESTQSAKPSSAQQATELWEVVEEPRGRLGAEGIMPERQEGHLLKKRKW
PLKGWHKRYFVLEDGILHYATTRQDITKGKLHGSIDVRLSVMSINKKAQRIDLDTEDNIY
HLKIKSQDLFQSWVAQLRAHRSAQHLDVPRSVLPSTSHRKVAGAQPPAVGSASALPGVGP
REKVSSWLRDSDGLDRCSHELSECQGKLQELHRLPQSPEAPHRVGDRGPPGPLPSCHIAS
VTTERPKKGKRTSRMWCTQSFAKDDTIGRVGRLHGSVPNLSRYLESRDPSGPRGLPPPDY
AHLQRSFWALAQKVHSSLSSVLAALTAERDRLRDLHPGAGVGVVAVSETSAGPRRLHSLS
VSSDTTADSFSSLNPEEQEALYMKGRELTPQLSQSSVLSLADSHTEFFDACEVLLSASSS
ENEGSEEEESCTSEVTTSLSEEVLDLRGAERCQKGAHLWRGTGGLGGPPGRRCLPAASGP
GTDVSLWNILRNNIGKDLSKVSMPVQLNEPLNTLQRLCEELEYSSLLDRASRTADPCERM
VYIAAFAVSAYSSTYHRAGCKPFNPVLGETYECERPDRGFRFISEQVSHHPPISACHAES
ENFIFWQDMKWKNKFWGKSLEIVPVGTVNVSLPRFGDHFEWNKVTSCIHNILSGQRWIEH
YGEVLIRNTQDSSCHCKLTFCKVGDRLPPLSAPAAPPPGGEGASLFVPFWGAGGGGGRVH
LPQPPAFPLDSMPPNYERNFGFTQFALELNELTAELKRSLPSTDTRLRPDQRYLEEGNIQ
AAEAQKRRIEQLQRDRRKVMEENNIVHQARFFRRQTDSSGKEWWVTNNTYWRLRAEPGYG
NLDGAVLW
Download sequence
Identical sequences W5PE40
ENSOARP00000008704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]