SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008717 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008717
Domain Number 1 Region: 135-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 75-123
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000497
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 120-147,211-224,512-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000119
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008717   Gene: ENSOARG00000008121   Transcript: ENSOART00000008844
Sequence length 610
Comment pep:known_by_projection chromosome:Oar_v3.1:1:31284251:31329404:-1 gene:ENSOARG00000008121 transcript:ENSOART00000008844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSCGQISCCRGKMKTSRTWAWRVPAELFLLCAALGSFSVPSSRGEKLPSLGSNAVNESLA
KTRQTRSVDVTPLPIDCELSSWSSWTTCDPCQKKRYRHAYLIRPSQFHGEPCSFSDKEVE
DCVSNRPCRSQVRCEGFVCAQTGRCINRRLLCNGDNDCGDQSDEANCRKIYKKCQQEMEQ
YWAIGRLASGINLFTNNLEGPVLDHRYYAGVCSPHYILNTRFRKPYNVENFIPQTRGKSE
FTLTEYESYSDFEHNVTGTAMSKSSFSLGFKIPGIFELGYSSTSNIGQHFISRIKRFSHT
KSKFLHARSDLEVAHYKLKPRNLMLHHEFLQRVKRLPLEYSYGEYRDLFHDFGTHYITEA
VLGGIYEYTLIMNKEAMERGDYSLKDVHDCAKHDFKIGAAIIAVYVNLGVSEATCSNILN
EIKDRNKTDSMVEDLVVLVRGGASEYVTALAYRELPTADLMQEWGDAVQYNPDIIKVKVM
PLYELVTATDFAYSSTVKQNMMKALEEFQKEVSSCQCAPCQGNGVPVLKGTRCDCICPAG
FQGSACEVTHRKNVPIDGKWNCWSNWSPVLEDIKQDKGSAPIHLLEMGATPAWALLQKHL
TVKEGKAFGR
Download sequence
Identical sequences W5PE53
ENSOARP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]