SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008728 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008728
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008728   Gene: ENSOARG00000008136   Transcript: ENSOART00000008855
Sequence length 256
Comment pep:known_by_projection chromosome:Oar_v3.1:2:28308571:28332142:-1 gene:ENSOARG00000008136 transcript:ENSOART00000008855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRAAATLRRRARPGGRKENAMPTPGNGTGMCVQLQQPLQGTFQVLRGDGTSVGTVIVFH
CPSGHQMVGSGLLTCAWKGNIAEWSSGTPMCKTVPLYETFGFKVAVISSIVSCAIIMLMS
MAFLTCCFVKCVKRSEQRRSDRANQLWHQLRHEDLETVQAPYLGLKGLNSDSSISGVSRI
QPVQVHDNHSFTTDLGEGTRELASMARGVDKDFWTASGPTSSPRAQVMVHTASPGQIPPP
SRPTVMLRQPAAYVPG
Download sequence
Identical sequences W5PE64
XP_004004120.1.66739 ENSOARP00000008728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]