SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008777 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008777
Domain Number 1 Region: 31-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-19
Family Spermadhesin, CUB domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008777   Gene: ENSOARG00000008184   Transcript: ENSOART00000008905
Sequence length 134
Comment pep:novel chromosome:Oar_v3.1:22:41418918:41424308:1 gene:ENSOARG00000008184 transcript:ENSOART00000008905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSVIPWALLLSTATSDSTDRLSFKDKNLCGDLYEEEYGVIYPYLGLHTECLWTIKMD
PGHKIVLAVYDLHLNCDKESLEIIDGPPESSSSLKFCDKPYLEYASCTNTMIVKYTRMPN
HPVPNFLLTFRRVL
Download sequence
Identical sequences W5PEB3
ENSOARP00000008777 XP_014958970.1.66739 XP_014962323.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]