SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008812 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008812
Domain Number 1 Region: 904-973
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-17
Family Complement control module/SCR domain 0.00039
Further Details:      
 
Domain Number 2 Region: 652-721
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.24e-17
Family Complement control module/SCR domain 0.0005
Further Details:      
 
Domain Number 3 Region: 531-602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.15e-17
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 4 Region: 82-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.03e-16
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 5 Region: 143-211
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000278
Family Complement control module/SCR domain 0.000053
Further Details:      
 
Domain Number 6 Region: 787-846
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000567
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 7 Region: 340-409
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000057
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 8 Region: 1290-1356
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000667
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 9 Region: 727-797
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000117
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 10 Region: 276-340
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000013
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 11 Region: 1156-1218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00059
Further Details:      
 
Domain Number 12 Region: 1040-1103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000189
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 214-278
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.00033
Further Details:      
 
Domain Number 14 Region: 592-663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000702
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 15 Region: 979-1049
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000012
Family Complement control module/SCR domain 0.00047
Further Details:      
 
Domain Number 16 Region: 1344-1408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 17 Region: 467-525
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000945
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 18 Region: 398-460
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.00018
Further Details:      
 
Domain Number 19 Region: 1225-1284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000612
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 20 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000513
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 1123-1167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000264
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Domain Number 22 Region: 865-915
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000621
Family Complement control module/SCR domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008812   Gene: ENSOARG00000008208   Transcript: ENSOART00000008940
Sequence length 1473
Comment pep:known_by_projection chromosome:Oar_v3.1:12:4724266:4770968:1 gene:ENSOARG00000008208 transcript:ENSOART00000008940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGPILVFLTLLTPGVLGQCKFLPRYPFAKPKIQSDQSEFAVGKTWEYECLPGYFKKS
FTVTCLKTSQWSNAQQFCKRKSCTVPKELLHGSVHTPQGIVFGATITFSCDKGYRLIGDS
SAMCTISDNTVTWDKDLPLCESIPCEPPPTISNGDFHGSNREYFHYGMVVTYQCHVGQNG
KKLFDLLGEKSIYCTSKDNQVGLWNSPPPQCIPVVKCPFPEVENGVVESGFRLSFSLNDS
VMFKCKPGFTMKGSNTVWCQPNSKWNPPLPKCFKGCLPPPHTHHGNYNQLDEEFFAVGQE
VFYSCEPGYTLIGTNPIQCTSLGTWSHLAPKCEVKSCDDIPNQLLNGRVIAPPNLQLGAE
VSFVCNKGYRLNGQSSSQCVSEGMRVLWSNKFPVCERIFCDPPPSIKNGRSGYHSGPVAL
NAVVTYSCASTFRLIGERRLFCISKDNVNGIWDKAPPICEYYNRNSVCSEPIIPGGYRTK
TSRPPFRHGDAVTFSCNANFTMKGNKTVWCQANRKWGPTPLPICESDTPLECPSLPTIAN
GHHTGESVASFAPGLTVTYSCEPGYLLLGENTIHCLSSGDWSAVAPTCKEAQCEPPRSFL
NGQIKRPTSFGVGATVNFSCNEGYRLQGPLSSRCVIVEQRTFWTKMPACEEILCPSPPPI
LNGRHTGTSSVIFRYGRTVSYTCDPGPEKGVNFILVGERTIRCTTDSQKTGTWSGPAPRC
ELSVSEVRCPPPQIPRGQISSGQRDQYSYNDTVVFACIFGFTMKGSRAVRCNAQGTWEPS
VPVCEKDCQAPPKILNGQKEDRHRVRFDPGTSIRYSCDPGYVLVGEESIRCTPDGVWIPT
APICKKAAECEPVGKQVFKKPKNQFIRPDVNSSCDEGYRLGESVYQQCRGTFPWFMEIRL
CKDITCPPPPAIYNGVHTGSSSEDVLYGTTVTYTCYPGPERGVKYNLIGESTIHCISNDQ
GTGIWSGPAPLCKLSLPAVQCSHVRIENGYKISGKEAPYFYNDSVVFKCDDGFILRGSSQ
VRCKANNTWDPEIPVCEKGCQPPSGLHHGWHTGGNRVLFVSGMTVDYTCDPGYLLVGNRS
IHCMPSGNWSPSVPRCEEAQCQPLGEDVQKPPVGSPVVPANTSCQDGYRMKNYIYQKCQD
DENRVWFQKIPVCEIINCKDPPRINNGKHRGVLPGGFRYGNEVSYECDQGFDLLGEKSIR
CIIDSQGNGSWSGPAPQCIKSRPVTHCPNPEVMHGHKLNKTYSSYSHNDILHIACNPGFV
MNGSHLIRCHTNNKWVPGVPTCIKKAFLGCQRPFTISHGNHTGGDITRFSPGMSIMYSCN
QGYLLVGEALLLCTHEGTWNRPAPYCKEVNCSFPEHLNGIQNGLEPGRMYQYGAVVTLAC
EDGYTLEGSPQSQCQEDHRWNPPLAVCKSPSSLAPLIAGFSAGVIALFCLGVVTLRMILK
HRERNYYTNTNHKEDVHLEALDIYSADPYSPAN
Download sequence
Identical sequences W5PEE8
ENSOARP00000008812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]