SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008873 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008873
Domain Number 1 Region: 27-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008873   Gene: ENSOARG00000008273   Transcript: ENSOART00000009002
Sequence length 135
Comment pep:novel chromosome:Oar_v3.1:22:41451937:41457647:1 gene:ENSOARG00000008273 transcript:ENSOART00000009002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSSVIPWALLLSTATVDSMDWLPRNTNCGGILNEESGVIATYYGKKTNCVWTIQMPPQ
YQARVSIQQLHLNCAKEYLEIIDGLPGSSVLGRVCEGSFLEYRSSGNTMTVKYFRKPEHL
TSSYEVLYFQDSQGR
Download sequence
Identical sequences W5PEK8
ENSOARP00000008872 ENSOARP00000008873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]