SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008878 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008878
Domain Number 1 Region: 61-133
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.31e-22
Family Ribosomal protein S18 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008878   Gene: ENSOARG00000008279   Transcript: ENSOART00000009007
Sequence length 196
Comment pep:known_by_projection chromosome:Oar_v3.1:20:17255738:17280646:-1 gene:ENSOARG00000008279 transcript:ENSOART00000009007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALNVLVSGCGRFLRGLLTGPTVTSWARPPARWLREVVEIQEGKTTIIEGRITGTPRES
PNPPNPSGQCPICRWNLKHKYSYEDVLLLSQFIRPHGGMLPRRVTGLCQEEHRKIEECVK
MAHRAGLLPNHRPKLPEGFVPKTRPRLNRYLTRWSPRSVKPIYNKGHRWNKVRMAVGSPL
LKDNVSYTGRPLVLYH
Download sequence
Identical sequences W5PEL4
ENSOARP00000008878 XP_004018899.1.66739 XP_005696404.1.57651 XP_011969358.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]