SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008918 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008918
Domain Number 1 Region: 168-415
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.91e-85
Family Eukaryotic proteases 0.00019
Further Details:      
 
Domain Number 2 Region: 35-160
Classification Level Classification E-value
Superfamily SEA domain 2.62e-31
Family SEA domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008918   Gene: ENSOARG00000008316   Transcript: ENSOART00000009048
Sequence length 416
Comment pep:known_by_projection chromosome:Oar_v3.1:6:83834645:83853787:-1 gene:ENSOARG00000008316 transcript:ENSOART00000009048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPVTISRTSFPLWMIFLIVFGVVAILGTTIGLLVHFLAVENKTYYYQGSFKVLNIPYN
RNYEKETSQENNYLSKILETKMSDAFQSSSIYRQYINSQVITLVPADNSVTAHIWLVFKA
PKSMKENTRRGIESILRQMLRNQSGSLTTDPDSLTLKEISKVEAEKIINNRCGRRPRMSA
TYDRIKGGSTAQEGEWPWQASLKKNGRHYCGASLISDRYLVTAAHCFKNSQDPRNYTVTF
GTKVNRPYMQHYVQQIFIHENYIRGELHDDIAVILLTEKVLFKNDVHSVCLPEATQSFPP
GEGVVVTGWGALSYDGEYPVLLQKAPVKIIDTNTCNAQEAYDGVIQDTMLCAGYMEGTID
ACQGDSGGPLVHPNSRNIWYLVGIVSWGAECGTINKPGVYTRVTAYRNWIASKTGI
Download sequence
Identical sequences W5PEQ4
ENSOARP00000008918 XP_004009915.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]