SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000008948 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000008948
Domain Number 1 Region: 173-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000406
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 2 Region: 34-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000141
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000008948   Gene: ENSOARG00000008346   Transcript: ENSOART00000009078
Sequence length 269
Comment pep:known_by_projection chromosome:Oar_v3.1:2:243860252:243868076:-1 gene:ENSOARG00000008346 transcript:ENSOART00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVYPPQLPQRLLLLGAATLTASALHTADLVDLCGRTWPADGLLLRSHSASRRFYFVAPD
TDCGLWVRAAAPGDRIRLQFRFFLVYSLAPPSVPPALNASAPLPADPCAPGSYLQLYEGP
PGTPRPLGAPLCGLTIPAPVTTSGDLLGLRLVTRGRQPRVDFVGEVTSFRLGSCGGYFLC
RNGRCIPPSLVCDRWGMDNCGDGSDQASWPPANCRAPSPEPSQEGNTDDGASQTLTSSPA
LPSSGPLGTAAERSPPAHWDPARQGVALE
Download sequence
Identical sequences W5PET3
ENSOARP00000008948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]