SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009096 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009096
Domain Number 1 Region: 122-296,385-494
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.92e-42
Family FAD-linked reductases, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009096   Gene: ENSOARG00000008478   Transcript: ENSOART00000009228
Sequence length 572
Comment pep:known chromosome:Oar_v3.1:9:28005936:28027215:-1 gene:ENSOARG00000008478 transcript:ENSOART00000009228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTFLGIATFTYFYKKCGDFVSLANKELLLCVLVFLSLGLVLSYRYRSGALLGRRQSGSQ
LAGFSYILSALPFIGFFWAKSPAGSENKEQLGSRRCKKGTSISETTLIGTAASTLTSSQN
DPEVIIVGSGVLGSALAAVLSRDGRKVTVIERDLKEPDRILGEFLQPGGYYVLKDLGLED
TVEGIDAQVVNGYIIHDQESKTEVQIPFPLSENNHVQSGRAFHHGRFIMRLRKAAMAEPN
AKFIEGTVLQLLEEDDAVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKNLISNKVSI
SSHFVGFLMENAPQFKANHAELILANPSPVLIYQISPNETRVLVDVRGDMPRNLREYMTE
NIYPQLPDHLKGPFLEASQNSRLRSMPASFLPSSPVNKRGVLLLGDAYNMRHPLTGGGMT
VVFNDIKLWRKLLKGIPDLYDDAAVFQAKKSFYWTRKKSHSFVVNVLAQALYELFSATDD
SLHQLRKACFFYFKLGGKCVAGPVGLLSVLSPNPLVLIGHFFGVAVYATYFCFKSEPWIT
KPRAIFSSGAVLYRACSVIFPLIYSEMKYLVH
Download sequence
Identical sequences A6YQW0
ENSOARP00000009096 NP_001098399.1.54773 NP_001098399.1.66739 XP_005688908.1.57651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]