SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009115 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009115
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.26e-37
Family Dual specificity phosphatase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009115   Gene: ENSOARG00000008498   Transcript: ENSOART00000009247
Sequence length 189
Comment pep:novel chromosome:Oar_v3.1:17:69122374:69122994:-1 gene:ENSOARG00000008498 transcript:ENSOART00000009247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASPCAFPVPFRQPSVSGPSHIITSSLYISSGVAANNRLMLSSNRISTVINVSVEVVNT
LYEDIHYVQVPVADTPTSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYL
MKYHAMSLLDAHTWTKSCRPIIRPNNGFWEQLIHYEFQLFGRNTVRMVSSPVGVIPDIYE
KEVRLMIPL
Download sequence
Identical sequences W5PFA0
ENSOARP00000009115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]