SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009179 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009179
Domain Number 1 Region: 15-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.8e-81
Family Regulator of chromosome condensation RCC1 0.012
Further Details:      
 
Domain Number 2 Region: 355-465
Classification Level Classification E-value
Superfamily POZ domain 7.46e-25
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009179   Gene: ENSOARG00000008556   Transcript: ENSOART00000009312
Sequence length 531
Comment pep:known_by_projection chromosome:Oar_v3.1:10:19413958:19448600:-1 gene:ENSOARG00000008556 transcript:ENSOART00000009312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDVGKWPIFTLLSPQEIASIRKACVFGTSANEALYVTDSDEVFVFGLNYSNCLGTGDNQ
STLVPKKLDALCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGLAPIQ
VCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHI
KRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVC
GYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVIEIAACHSAHTSAA
KTQGGHVYMWGQCRGQSVTLPHLTHFSSTDDVFACFATPAVTWRLLSAEHEDFLTVAESL
KKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYAV
YRAFLQYLYTDAVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAV
RYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN
Download sequence
Identical sequences W5PFG4
XP_004012127.1.66739 XP_005979226.1.78601 XP_011979894.1.54773 XP_011979895.1.54773 XP_011979896.1.54773 XP_011979897.1.54773 XP_011979898.1.54773 XP_011979900.1.54773 XP_011979901.1.54773 XP_012039858.1.66739 XP_012039859.1.66739 XP_012039861.1.66739 XP_014953552.1.66739 XP_014953553.1.66739 XP_014953555.1.66739 XP_014953556.1.66739 XP_014961229.1.54773 XP_017912226.1.57651 XP_017912227.1.57651 XP_017912228.1.57651 ENSOARP00000009179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]