SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009356 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009356
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.59e-37
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 2 Region: 86-241,386-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.92e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 993-1026
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000648
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000009356
Domain Number - Region: 1027-1056
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000214
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009356   Gene: ENSOARG00000008705   Transcript: ENSOART00000009493
Sequence length 1971
Comment pep:known_by_projection chromosome:Oar_v3.1:15:39966160:40150650:-1 gene:ENSOARG00000008705 transcript:ENSOART00000009493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQTQAGQIFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALILGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATHYQLPSLDFAMNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTSPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKHLYITKELHQYPLERLGSVRRSVGLSRRESDIRPSKLLTWCQQQTEGYQHVSVTD
LTTSWRSGLALCAIIHRFRPDLINFDSLNEDDAVENNQLAFDVAEREFGIPPVTTGKEMA
SAQEPDKLSMVMYLSKFYELFRGTPLRPVDYWRKNYEENADLGLAKSSIPHHYLNLTFPR
KRTPRVDSRTEENDMNKRRRKGFNNLDEPSAFSSHSLGANQEGIKEGGNQNKVKSMASQL
LAKFEESSRNPSILRQEHRVSGIGKPILRSSSDPPVNSRGPKPEEPTPSPSPPLKRQFPS
MVVTGHVLREIKQVSAGGECPARPWRARAKSDLQLGGPENLTSLPPTCPGALALSGVLRR
LQQVEEKVLQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNKLLSKSLSHTHPPSS
PSCLPSPDSAATSSPSTVDSVSPARKAKKSPSSGGEVQPGHLVFLGPPLTVGKVSSGIGA
AAEVLVNLYLNDHRPKTQATSPDLESVRKTFPLNVGGSDTCYFCKKRVYVMERLSAEGHF
FHRECFRCSTCATTLRLAAYAFDVDEGKFFCKSHFIHCKTNSQQRKRRAELKQQKEEEGM
WKEQEAPRRDPPAESSCAAAAIATPEGSPPDEPTSPKKPKSIPEPEPGDVAGGPASPPPS
EWTSVRISPGEDVVGQDVLAVRVLVTSDDSSSDAELDHADSEASNAEPSDKRPPRLELQL
PPLLKPLTRHSSLREALTRAVSPHDLGEPEAVPALQWANSFQCPTPSEYQSGRRFQSNFI
PVNHKMTVLPPKEACPPLPPPSPSSSSSTDDLNALDSPSLTQVTVFNTPSQISRGHFSPS
TPIFLRRAKAHGPPKDLPLRLPHGQVLERMEYCLVRPGGDGLESSRPPSPAETASDGCQE
AVAPPRDIRSIHRGPHPVEGKDRCLPDHPLSPWAGEEPGEGSSRPRRVEDGGLELAEKSG
LKKLVLTPEQKTWLLDWNDSNLENLHLETGARLSQKSTKNGTGGGVLKPVRPLLLPRAEK
ESLPAQRQSQEKMRAPAERAPGERSTAPPKSPLRLIANAIRRSLEPLLPNSDGGRKAWAK
PESKTLPTSPPHAYTRSFSFRKSSSSKDSDQPSPKRDVASKASAFFSLGSPTARAAQPSA
LSPPAPAFGTHSLPSRPSKVFPACVPQPCGRIKDVPTLLEKVSLRETVPDASRVPKKRTS
LFSSFRLKDKSFESSLQESGPRKDSQDLFSSPKGKVPPMGNAQPPEKQVQPVSSTCLGQK
VPPSPEKDASPTHVPIRAQGTGTVSSTSSSTTSSADEEFHPQPSSRSKERKALRRRRKLE
KATKQLVKQEELKRLHKAQAIQRQLEEVEERQRASEIQGVRLEKALRGEAADSGTQDEAQ
LLQEWFKLVLEKNKLMRYESELLIMAHELELEDHQSRLEQKLREKMLQEVESQKDENDLN
EEQEILTEMMQVIEQRDKLVDSLEEQRIREKAEDQHFESFIFSRGSQLSRT
Download sequence
Identical sequences W5PFZ1
ENSOARP00000009356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]