SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000009383 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000009383
Domain Number 1 Region: 209-362
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.1e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000906
Further Details:      
 
Domain Number 2 Region: 101-199
Classification Level Classification E-value
Superfamily LCCL domain 1.57e-25
Family LCCL domain 0.00077
Further Details:      
 
Domain Number 3 Region: 2-97
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000009383   Gene: ENSOARG00000008739   Transcript: ENSOART00000009520
Sequence length 659
Comment pep:known_by_projection chromosome:Oar_v3.1:8:20304221:20378898:-1 gene:ENSOARG00000008739 transcript:ENSOART00000009520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKNYPGTYPNHTLCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFSSSSDQYGPYC
GSMTMPKELLLNTNEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERANHYLKTEYSK
FCPAGCRDIPGDISGNVVDGYRDTSLLCKAAIHAGVIADEVGGQISVFLRKGISRYEGIL
ANGVLSRDGSLSDKRFLFTSNGCSGSLILEPDRQIRASSSWEWINETGDQVRWSPGQARL
QDQGPSWASGDRSKNHKQREWLRIDLGEKKKITGIRTTGSTQSNFNFYVKSFVMNFRNNN
SKWKTYKGIVNNEEKVFQGNSNFRDPVRNNFIPPIVARYVRVIPQTWHQRIALKVELLGC
QIAPSRTQGNDSLVWHKTSVNTVGSTKGEDKTISKPIPSEEVPKGLNITTIVIPLVLFFF
VLAVGVGIFAVLRKKKKKGNPYGSSKTQKTDCWKQIKYPFARHQSAEFTISYDNEKEMTQ
KLDLVTSDTADYQQPLMIGTETVTRKGSTFRPMDTEADAAGSGTEAGGHYDCPLPAGRHE
YALPLTNPEPEYATPIVERHLARAHTFSARSGYRVPGPRPAHKHSLSSGAFSPAAGYQRP
PSPAPAEPGYDQPKGGGLAAGCAPPDHQKPQVGPAGSPAYLAPRDCLRPLSPTAMTALL
Download sequence
Identical sequences W5PG18
ENSOARP00000009383 XP_012037913.1.66739 XP_014952816.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]